.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d7q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Site-specific recombination of nitrogen-fixation genes in cyanobacteria by XisF-XisH-XisI complex: Structures and models. Proteins 2014
    Site JCSG
    PDB Id 3d7q Target Id 368193
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1536,NPUN_22DEC03_PLASMIDA_REVISED_GENEPNPAR114, BIG_402, BIG_57, 86215 Molecular Weight 13168.40 Da.
    Residues 111 Isoelectric Point 5.63
    Sequence mdklneyrtkvrqlltkhlqykpsygdveveqifdeehdhyqiisvgwnnqhriygpimhldiknnkiw iqqntteadialelmemgidkqdivigfhtpkmrqlsgfave
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.259
    Matthews' coefficent 2.20 Rfactor 0.206
    Waters 57 Solvent Content 43.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d7q
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    Gene Npun_AR114 from Nostoc punctiforme pcc 73102 encodes the YP_0018700030 amino acid sequence, an fdxN element excision controlling factor protein that belongs to the XisI group (PF08869). Its genome neighborhood includes the presence of another fdxN element, the XisH protein (score 0.87).

    SCOP classifies 3d7q in the alpha+beta class, XisI-like (super)family. There are only three structurally similar proteins (Dali Z-scr=18) found in PDB (PDB:2nlv (Z=17), PDB:2nvm and PDB:2nwv (both Z=15)). They are the first group of crystal structures from the XisI-like protein family.

    3d7q functions as a dimer, with one monomer (green) and its symmetry partner (pink) depicted below. 

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (1)

    FileSizeDateAttached by 
     assemblyA.png
    No description
    202.46 kB22:03, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch