.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d7i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from METHANOCOCCUS JANNASCHII at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 3d7i Target Id 381877
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS1762,1591455 Molecular Weight 11702.39 Da.
    Residues 104 Isoelectric Point 8.62
    Sequence mknevffgegmkvvkekypdlydiivklndtvftgktldyktqkliaigivasrcdevaiekqmksamk elgitkeeiadvlrvvlltsgmpaftkamkilekl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.75 Rfree 0.197
    Matthews' coefficent 2.67 Rfactor 0.170
    Waters 104 Solvent Content 53.92

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d7i
    1. Target domain definition and classification in CASP8
    ML Tress, I Ezkurdia - : Structure, Function, and , 2009 - Wiley Online Library
     
    2. Reliable protein structure refinement using a physical energy function
    MS Lin, T Head_Gordon - Journal of computational chemistry, 2011 - Wiley Online Library
     
    3. Crystallization and preliminary X-ray crystallographic analysis of-carboxymucolactone decarboxylase from Sulfolobus solfataricus
    HY Lee, JK Yang - Section F: Structural Biology and Crystallization , 2009 - scripts.iucr.org
     
    4. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary

    JCSG Structure Refinement Summary

    381877 is a hypothetical protein that belongs to the carboxymuconolactone decarboxylase family, PFAM PF02627. The monomeric structure is all-helical, with a four-helix bundle connected to two additional helices through a linker region (Fig 1). The biologically relevant form is likely a hexamer, which is formed via significant interactions between the chains (Fig 2).


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch