.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 3d7i

3d7i

    Page last modified 03:34, 21 Dec 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from METHANOCOCCUS JANNASCHII at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 3d7i Target Id 381877
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS1762,1591455 Molecular Weight 11530.15 Da.
    Residues 104 Isoelectric Point 7.77
    Sequence mknevffgegmkvvaaaypdlydiivklndtvftgktldyktqkliaigivasrcdevaiekqmksamk elgitkeeiadvlrvvlltsgmpaftkamkilekl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.75 Rfree 0.197
    Matthews' coefficent 2.67 Rfactor 0.170
    Waters 104 Solvent Content 53.92

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    JCSG Structure Refinement Summary

    381877 is a hypothetical protein that belongs to the carboxymuconolactone decarboxylase family, PFAM PF02627. The monomeric structure is all-helical, with a four-helix bundle connected to two additional helices through a linker region (Fig 1). The biologically relevant form is likely a hexamer, which is formed via significant interactions between the chains (Fig 2).


    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    • No tags
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch