.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d4e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative beta-lactamase inhibitor protein (NP_721579.1) from STREPTOCOCCUS MUTANS at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 3d4e Target Id 390321
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS1787,NP_721579.1, 87553 Molecular Weight 19962.15 Da.
    Residues 178 Isoelectric Point 6.04
    Sequence edkkggtkpsneaaltktenldfrlsfnkikvttdqnhfsggtsieqlkqwfgdpnkseqrnagnitld sytwvkdgavinaqlyknstvarsisnfsfsreakigkedydelkigesykkvveklgepdvlsqsmss dkeemqtvwssgiktksssatielyfengllknktqkdle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.201
    Matthews' coefficent 2.08 Rfactor 0.175
    Waters 158 Solvent Content 40.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d4e
    1. The structure of BVU2987 from Bacteroides vulgatus reveals a superfamily of bacterial periplasmic proteins with possible inhibitory function
    D Das, RD Finn, D Carlton, MD Miller - Section F: Structural , 2010 - scripts.iucr.org
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary

    NP_721579.1 is another example of a unexpected structural similarity to beta-lactamase inhibitory proteins (BLIP) which already include 1XXM, 1S0W, 1JTG, 2G2U, 2G2W and 2B5R, as well as our own recent structure, 3due. All of structures are involved in beta-lactamase inhibitor complex. The N-terminal of NP_721579.1 orients in the same way as the other structures. NP_721579.1 is a monomer in solution according to the calculation of interface interaction (PISA). During the refinement, there were no ligand or metal ions observed and modeled in the structure.

    Ligand Summary

    Acetate ion

    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch