.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d1c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Flavin-containing Putative Monooxygenase (NP_373108.1) from STAPHYLOCOCCUS AUREUS MU50 at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 3d1c Target Id 382610
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS1767,NP_373108.1 Molecular Weight 41164.87 Da.
    Residues 368 Isoelectric Point 5.24
    Sequence mqhhkvaiigagaagigmaitlkdfgitdviilekgtvghsfkhwpkstrtitpsftsngfgmpdmnai smdtspaftfneehisgetyaeylqvvanhyelnifentvvtnisaddayytiatttetyhadyifvat gdynfpkkpfkygihyseiedfdnfnkgqyvviggnesgfdaayqlakngsdialytsttglndpdadp svrlspytrqrlgnvikqgariemnvhytvkdidfnngqyhisfdsgqsvhtphepilatgfdatknpi vqqlfvttnqdikltthdestrypnifmigatvendnaklcyiykfrarfavlahlltqreglpakqev ienyqknqmylddysccevsctc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.225
    Matthews' coefficent 3.12 Rfactor 0.181
    Waters 115 Solvent Content 60.57

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    NP_373108.1 is a likely  flavin-containing monooxygenase  (FMO), it is structurally similar to FMO from S. pombe (RMSD 2.36 for 264 aligned Ca, PDB code 2gvc/1vqw/2gv8). The solved structure contains a FAD. It also contains an unidentified ligand at the same place of methimazole in SmFMO. The active site residues,  though somewhat similar to SmFMO, are not completely conserved, suggesting possible differences in substrate specificity. O2*,O3*,O4* positions of FAD in this enzyme also differs from SmFMO.

    NP_373108.1 functions as a monomer. It may also bind NADPH or NADH (NP_373108.1 contains a Pyridine nucleotide-disulphide oxidoreductase (PF07992: Pyr_redox_2) domain from Pfam, which according to Pfam is a small NADH binding domain within a larger FAD binding domain. 





    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch