.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cwr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of transcriptional regulator of TetR family (YP_425770.1) from Rhodospirillum rubrum ATCC 11170 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 3cwr Target Id 379808
    Molecular Characteristics
    Source Rhodospirillum rubrum atcc 11170
    Alias Ids TPS1748,YP_425770.1, 3.10.450.50, 87158 Molecular Weight 22411.45 Da.
    Residues 207 Isoelectric Point 8.14
    Sequence mveqrnrgrpavpdavvresivgaaqrllssggaaamtmegvaseagiakktlyrfasgradligllve swiapifpgfeadpqdaaaalerivydiaqavlsreavslfrmlasdadlrnrflpaynangiersrre larwldqqasagrlplpipaervadlllsaviaeplrqitlglreplpawdiaprvadavrliapgrer
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.186
    Matthews' coefficent 2.12 Rfactor 0.149
    Waters 327 Solvent Content 41.99

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cwr
    1. Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolorA3 (2) reveals an unusual dimer among TetR family proteins
    EV Filippova, M Chruszcz, M Cymborowski - Journal of structural and , 2011 - Springer
     

    Protein Summary

    This is a Transcriptional regulator protein, belonging to TetR family. The structure is all helical as are the other members of the family. Belongs to PFAM PF00440 (http://pfam.sanger.ac.uk/family?acc=PF00440).  The biological unit of the protein is a dimer as shown in Fig 1.

    Fig. 1 The dimer structure.

    Several structures in  this PFAM family have been determined, including  about eight structures from JCSG.  A comparison with a few structures underscores the structural homology in Fig 2.

    Fig 2. Superposition of this structure (green) with homologs 2f07 (cyan), 2g3b (magenta), 2zb9 (yellow), 3bhq (pink), and 3c2b (grey).

    This transcriptional regulator of TetR family (YP_425770) and proteins with putative antimicrobial activity are encoded by neighboring genes.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
    FN9673I.png
    No description
    107.1 kB22:05, 30 Jun 2008dweekesActions
    FN9673I_all.png
    No description
    94.54 kB22:05, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch