.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cvj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of putative phosphoheptose isomerase (NP_244191.1) from Bacillus halodurans at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3cvj Target Id 379051
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1730,NP_244191.1 Molecular Weight 26783.17 Da.
    Residues 242 Isoelectric Point 6.24
    Sequence mtssftdyckffnrilsevqetqeqaiikgahlvseavmnggrfyvfgsghshmiaeeiynragglalv tailppelmlherpnkstylerieglsksylklhqvtnkdvimiisnsgrntvpvemaiesrnigakvi amtsmkhsqkvtsrhksgkklyeyadvvldngapvgdagfqianseiysgatsdsigcflaqalivetl hllvqqgfeppvfkssnvdgadlyndkifneyvkw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.221
    Matthews' coefficent 2.02 Rfactor 0.174
    Waters 415 Solvent Content 39.16

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene BH3325 from Bacillus halodurans encodes the NP_244191 amino acid sequence that shows a weak hit (E-val=1.2e-3) with the Sugar Isomerase group (PF01380). A functional link (score 0.7) is made by genome context analysis with the glucose-1-phosphate thymidyl-transferase BH3324. 

    Pre-SCOP classifies 3cvj in the alpha/beta class, SIS domain superfamily. 3cvj structure belongs to the alpha beta class having 3-layer (abc) sandwich architecture. There are four molecules in asu as shown below. The predicted biological molecule is a dimer supported by SEC/SLS. A Mg ion is coordinated by the side chains of His-53 and Glu-57 from both chains A and B. 

    DALI top hits (Z=19) for a 3cvj structural similarity search are phosphoheptose isomerases PDB:3bjz, PDB:2i2w and the hypothetical protein HI0754 PDB:1nri. Superposition with the SSM best hit (PDB:1x92 - phosphoheptose isomerase; Z=18) with 3cvj is shown below.


     

    Ligand Summary

    Magnesium (Mg) and acetate (ACT) ions from crystallization and ethylene glycol (EDO)
    from cryo condition were modeled.


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch