.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cuc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Protein of Unknown Function with a Fic Domain (NP_811426.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.71 A resolution. To be published
    Site JCSG
    PDB Id 3cuc Target Id 371850
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS1598,NP_811426.1, BIG_271, PF02661, 430155 Molecular Weight 33145.95 Da.
    Residues 290 Isoelectric Point 5.72
    Sequence mgisnikqlyskwkslqplkpedlkrwndkfklefnynsnhlegntltygqtklllmfgetsgnaslkd yeemkahnvglemikqeaqdkerpltesfirelnrtilvqdywknaktpdgqdirmqikvgeyksrpns vltatgevfsyaspeetpafmtslvdwynleadkgiltpvelaallhyryirihpfedgngriarllvn fvlhrygypmivihsedksnylnilhqcdveagltpsdganatlndilpfvnylssclirsltlaikaa kgesieeegdfdkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.71 Rfree 0.248
    Matthews' coefficent 4.99 Rfactor 0.222
    Waters Solvent Content 75.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cuc
    1. Fido, a novel AMPylation domain common to fic, doc, and AvrB
    LN Kinch, ML Yarbrough, K Orth, NV Grishin - PLoS One, 2009 - dx.plos.org
     
    2. Structural basis of Fic-mediated adenylylation
    J Xiao, CA Worby, S Mattoo, B Sankaran - Nature structural & , 2010 - nature.com
     
    3. Fic domain_catalyzed adenylylation: Insight provided by the structural analysis of the type IV secretion system effector BepA
    DV Palanivelu, A Goepfert, M Meury, P Guye - Protein , 2011 - Wiley Online Library
     
    4. AMPylation: something old is new again
    AR Woolery, P Luong, CA Broberg - Frontiers in Microbiology, 2010 - ncbi.nlm.nih.gov
     
    5. Crystal structure of the Fic (Filamentation induced by cAMP) family protein SO4266 (gi| 24375750) from Shewanella oneidensis MR_1 at 1.6 resolution
    D Das, S Krishna, D McMullan - Proteins: Structure, , 2009 - Wiley Online Library
     
    6. Comparative analysis of Histophilus somni IbpA with other FIC enzymes reveals differences in substrate and nucleotide specificities
    S Mattoo, E Durrant, MJ Chen, J Xiao, CS Lazar - Journal of Biological , 2011 - ASBMB
     
    7. Comparative Analysis of Histophilus somni Immunoglobulin-binding Protein A (IbpA) with Other Fic Domain-containing Enzymes Reveals Differences in Substrate and
    S Mattoo, E Durrant, MJ Chen, J Xiao, CS Lazar - Journal of Biological , 2011 - ASBMB
     
    8. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     
    9. Performance of phased rotation, conformation and translation function: accurate protein model building with tripeptidic and tetrapeptidic fragments
    F Pavelcik, J Vaclavik - Acta Crystallographica Section D: Biological , 2010 - scripts.iucr.org
     

    Protein Summary

    Gene BT_2513 fromBacteroides thetaiotaomicron vpi-5482 encodes the NP_811426 amino acid sequence that belongs to the Fic group (PF02661).

    SCOP classifies 3cuc inside the Fic-like (super)family. The 3cuc structure is structurally similar (Dali Z-scr=20) to the Fic domain of another jcsg structure: 2qc0 (rmsd 2.6 for 223 Ca of 265 aligned, 17% seq id). The putative active site residues include H192 and N198 which are conserved.  The 3cuc structure below shows the sequence conservation and highlights the putative active site around H192.



     

    Bacterial proteins containing Fic domains have been shown to disrupt host cell processes after being delivered into eukaryotic host cells [Ref]. This disruption involves inhibition of eukaryotic signaling proteins Rho, Rac, and Cdc42 through the covalent addition of adenosine 5'-monophosphate (AMP), a modification that results in cell rounding and collapse of the actin cytoskeleton [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch