.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ct8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a Putative Glyoxalase (NP_243026.1) from Bacillus halodurans at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 3ct8 Target Id 367517
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1515,NP_243026.1, 86355 Molecular Weight 14950.06 Da.
    Residues 127 Isoelectric Point 6.12
    Sequence mlhhveinvdhleesiafwdwllgelgyedyqswsrgksykhgktylvfvqtedrfqtptfhrkrtgln hlafhaasrekvdeltqklkergdpilyedrhpfaggpnhyavfcedpnrikveivap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.246
    Matthews' coefficent 2.21 Rfactor 0.216
    Waters 28 Solvent Content 44.37

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein is currently classified as an unknown conserved protein. However, based on sequence analysis, it belongs to PFAM PF00903 (http://pfam.sanger.ac.uk/family?acc=PF00903) which is the family of  Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily. The protein seems to have two short domains (see Fig 1). Each domain is composed of a three-stranded sheet and a helix. A Zn ion is bound in the C-terminal domain. The biological unit is a dimer (see Fig 2).

    Fig 1. Monomer structure with Zn and an unknown ligand shown.

    Fig 2. Dimer of protein is the biologically relevant unit.

    Several homlogs of this protein exist. A few (1xqa 2rk0 2p7k 2p7l 2p7q) are shown below in Fig 3.


    Fig 3. Structural homologs superimposed on the protein (in green). The metal ions are shown as spheres. 1xqa has MG ion and 2p7q has MN ion bound at the Zn site.


    Ligand Summary

    ZN is bound to the protein. In homologous structures, the same site is occupied by other metals.
    There is a peptide like density coordinating ZN. This density may represent a biological substrate. An unknown ligand (UNL) has been modeled in this density.

    References

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch