.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cpx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative M42 glutamyl aminopeptidase (YP_676701.1) from Cytophaga hutchinsonii ATCC 33406 at 2.39 A resolution. To be published
    Site JCSG
    PDB Id 3cpx Target Id 375102
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS1646,YP_676701.1, 3.40.630.10, 104091 Molecular Weight 34277.17 Da.
    Residues 302 Isoelectric Point 4.90
    Sequence mqllkelcsihapsgneeplkdfileyirsnagswsyqpviyadndlqdcivlvfgnprtavfahmdsi gftvsynnhlhpigspsakegyrlvgkdsngdiegvlkivdeewmletdrlidrgtevtfkpdfreegd filtpylddrlgvwtalelaktlehgiiaftcweehgggsvaylarwiyetfhvkqslicditwvtegv eagkgvaismrdrmiprkkyvnriielarqtdipfqlevegagasdgrelqlspypwdwcfigapekda htpnecvhkkdiesmvglykylmekl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.39 Rfree 0.223
    Matthews' coefficent 3.12 Rfactor 0.187
    Waters 323 Solvent Content 60.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cpx
    1. Target highlights in CASP9: experimental target structures for the critical assessment of techniques for protein structure prediction
    A Kryshtafovych, J Moult, SG Bartual - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary

    This target belongs to the CATH family 3.40.630.10 of alpha-beta proteins and the zinc peptidase homologous superfamily. Analysis of molecular packing in the crystal structure indicates that the structure depiction shown below of the trimer in the asymmetric unit is the biologically stable trimeric form.

    This protein belongs to the Pfam family PF05343 comprised of the M42 family peptidases.
    The Conserved Domain Database gives hits to COG1363 (Cellulase M and related proteins involved in carbohydrate transport and metabolism) and predicted peptidase.
    PSI-BLAST gives hits to many peptidases. Structure of closest sequence homolog is 2FVG.pdb.

    Two Fe ions are bound at the putative active site comprised of amino acids H65, D146, E172, E173, D199, H277. This has been verified by xray fluorescence and anomalous difference Fourier calculations.

    Ligand Summary

    Two Fe ions bound at the putative active. See details below.

    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch