| Title | Crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (NP_295428.1) from Deinococcus radiodurans at 1.66 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 379311 | | Molecular Characteristics | | Source | Deinococcus radiodurans r1 | | Alias Ids | TPS1735,NP_295428.1 | Molecular Weight | 22712.68 Da. | | Residues | 199 | Isoelectric Point | 4.99 | | Sequence | mtikalfwdiggvlltngwdreqradvaqrfgldtddfterhrlaapelelgrmtlaeyleqvvfyqpr dftpedfravmeeqsqprpevlalardlgqryrmyslnnegrdlneyrirtfglgefllafftssalgv mkpnpamyrlgltlaqvrpeeavmvddrlqnvqaaravgmhavqcvdaaqlreelaalgvr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.66 | Rfree | 0.187 | | Matthews' coefficent | 2.38 | Rfactor | 0.160 | | Waters | 344 | Solvent Content | 48.40 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The protein belongs to the the hydrolase family of proteins: PFAM PF00702 (
http://www.sanger.ac.uk//cgi-bin/Pfam/getacc?PF00702). This family are structurally different from the alpha/ beta hydrolase family (Abhydrolase_1). This family includes L-2-haloacid dehalogenase, epoxide hydrolases and phosphatases. The structure of the family consists of two domains. One is an inserted four helix bundle, which is the least well conserved region of the alignment. The rest of the fold is composed of the core alpha/beta domain.

Figure 1: The core domain is on the left and the inserted helix bundle is on the right.
The crystal structure is a dimer:

Figure 2: Dimer structure.
However, the protein's biological unit may be a tetramer:

Figure 3: Biological unit predicted by PISA server.
There are several structural homologs of the protein: 2gfh 2go7 2fea 2p11 2hx1 2hcf 2hsz 2hi0 2hdo 2pke 2g80 2ho4 2hf2 etc. Most of these are hydrolases.
Ligand Summary
NA and phosphate ions are modeled in each monomer. These ions may occupy the ligand binding site.
References