.
The Open Protein Structure Annotation Network
PDB Keyword
.

3clo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of putative transcriptional regulator containing a LuxR DNA binding domain (NP_811094.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.04 A resolution. To be published
    Site JCSG
    PDB Id 3clo Target Id 383272
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS1770,NP_811094.1 Molecular Weight 29573.30 Da.
    Residues 257 Isoelectric Point 5.87
    Sequence mdvlqkeidevyathptahealdngiveqhqqfvrsltevnggcavisdlsnrksyvtvhpwanflglt peeaalsvidsmdedciyrrihpedlvekrlmeykffqktfsmspgerlkyrgrcrlrmmnekgvyqyi dnlvqimqntpagnvwlifclyslsadqrpeqgiyatitqmergevetlslseehrnilserekeilrc irkglsskeiaatlyisvntvnrhrqnileklsvgnsieacraaelmkll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.04 Rfree 0.217
    Matthews' coefficent 3.64 Rfactor 0.187
    Waters 494 Solvent Content 66.25

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    NP_811094.1 contains two domains (1-197, 198-257). The C-terminal domain contains a LuxR DNA binding domain and  has well defined structural homologs (rmsd<1 and seq id ~30), the N-terminal domain seems to be novel. There are no known structures which are highly homologous to the N-terminal domain.

    This protein is likely to function as a dimer. The two DNA binding domains of NP_811094.1 are placed in an interesting fashion. By superimposing the LuxR domains of this proteins and NarL-C/DNA complex, two strands of dsDNA can be approximately positioned onto NP_811094.1. Thus it appears that this protein severly bends the dsDNA or that it has to bind to separate strands of dsDNA.


    Fig 1. NP_811094.1 with modeled dsDNA

    This protein is likely to function as transcription regulator. The N-terminal domain can bind small molecule substrate. There are very few known sequence homologs for the N-terminal domain. It is thus not easy to infer whether it is the substrate binding site.



    Fig 2. Sequence conservation on NP_811094.1 dimer surface. cyan-least conserved, magenta-most conserved residues.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch