.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ck1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative thioesterase (YP_296387.1) from Ralstonia eutropha JMP134 at 1.74 A resolution. To be published
    Site JCSG
    PDB Id 3ck1 Target Id 379793
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS1747,YP_296387.1, 86657 Molecular Weight 16590.20 Da.
    Residues 149 Isoelectric Point 5.87
    Sequence mtavfrntvlvrfkhcdaagivfypryfemlndfiedwfaqaldwpfdamhgagqagvptadlhcrfva psrlgetltrelrvvklgqssftvqvrfmgpdsglrlevtqrlvcvdtdkiaprplpdpvrqamatyvd etlaatgspgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.74 Rfree 0.196
    Matthews' coefficent 3.08 Rfactor 0.174
    Waters 293 Solvent Content 60.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ck1
    1. Structure of the putative thioesterase protein TTHA1846 from Thermus thermophilus HB8 complexed with coenzyme A and a zinc ion
    T Hosaka, K Murayama, M Kato-Murayama - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The gene Reut_A2179 from Ralstonia eutropha encodes the YP_296387 protein, a member of the thioesterase superfamily (4HBT (PF03061) Pfam family). Analysis of its genome context indicates a possible functional link (score 0.9) with the abmG protein, a 2-aminobenzoate-CoA ligase, and the pobA protein, a para-hydroxybenzoate hydrolase. 

    Pre-SCOP classifies 3ck1 in the alpha+beta class, thioesterase/thiol ester dehydrase isomerase superfamily, 4HBT-like family. According to DALI, 3ck1 structure similar to 1s5u (Z=20), 2w3x (Z=19), 2oaf, 2egi, and 1z54 (Z=18).

    There is no CoA cofactor found in the predicted active site of 3ck1. This putative thioesterase (EC 3.1.2.-) may be involved in benzoate degradation via CoA ligation or in limonene and pinene degradation.

    The 3ck1 biological unit appears to be a tetramer as shown below.
    The superposition of 3ck1 [green] with the Dali best hit [2oaf (yellow)] is shown below.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch