.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cjl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of domain of unknown function (YP_050007.1) from Erwinia carotovora atroseptica SCRI1043 at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 3cjl Target Id 367548
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS1516,YP_050007.1, 289783 Molecular Weight 10317.63 Da.
    Residues 87 Isoelectric Point 6.83
    Sequence mgniyqitveekaehqrtlsfefslhddlfkllekvdgkmdmtpeqtqafmvglklfgevmmqqrkhpl fkefsapfrafmmnlkkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.220
    Matthews' coefficent 3.19 Rfactor 0.194
    Waters 56 Solvent Content 61.46

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cjl
    1. X-ray crystal structure of the streptococcal specific phage lysin PlyC
    S McGowan, AM Buckle, MS Mitchell - Proceedings of the , 2012 - National Acad Sciences
     

    Protein Summary

    Gene ECA1910 from Erwinia carotovora atroseptica scri1043 encodes protein YP_050007.1 which likely functions as a dimer (Figure 1).

     

     The 3cjl structure is likely a representative of a new fold with some resemblance to 3-helical bundle folds such as the serum albumin-like fold of SCOP. No significant hits reported by a Dali search. This protein is the first structural representative of a small (about 60 proteins) family of proteins that are found among proteo- and enterobacteria.

     

    3cjl monomer consists of a long N-terminal beta-hairpin followed by three alpha helices. The putative active site can be identified by sequence conservation. The highly conserved site (H26, D27, D28, L32, M61, K55, R65, F70, M81, K85, ) in each monomer forms a pocket between the 1st and 2nd helix (Figure 2). The electrostatic surface of the active site is mostly positively charged (Figure 3). The function of this protein is unknown, but the possible substrate may have the properties of being hydrophobic and negatively charged.

     

     

     

    Figure 1. 3cjl dimer structure

    Figure 2. 3cjl putative active site. The orientation of the molecule is the same as in Figure 1 (magenta=most conserved, cyan=least conserved).
     

    Figure 3. Electrostatics surface potential of 3cjl putative active site (blue=+, red=- electric charge)

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch