.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cje

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of OsmC-like hydroperoxide resistance protein (YP_509982.1) from Jannaschia sp. CCS1 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3cje Target Id 371655
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS1587,YP_509982.1, 91102 Molecular Weight 18100.89 Da.
    Residues 166 Isoelectric Point 5.20
    Sequence maltpdqmpdraevvftcngkavgkmrneldvamvkpfeerfalatdegafhggdasappplalfiagl tgcvmtqirafakrlkvtvtdldvecrvvwdwakagpvyetgpksfeidiilhspdpieaqqalieaak kgcfleqtlgqantirhrlkvgdtfida
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.164
    Matthews' coefficent 3.71 Rfactor 0.144
    Waters 140 Solvent Content 66.87

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The Jann_2040 gene from Jannaschia sp. CCS1 encodes for the YP_509982 protein that belongs to the osmotically inducible C (OsmC) group (PF02566, cl00767). Its genome context indicates a possible funtional link (score 0.87) with neighboring genes Jann_2039, a fumarylacetoacetate hydrolase, Jann_2038, a putative cyclase, and Jann_2037, a TRAP dicarboxylate transporter.

    SCOP classifies 3cje in the alpha+beta class, OsmC-like superfamily, YhfA-like family. DALI top hit is with 1lql (Z=10). There are several Pfam homologs of this structure in PDB: 1lql (Z=10), 1usp (Z=7), 2onf (Z=8), 2pn2 (Z=7), 2opl (Z=9), 2ql8 (Z=7), and 1vla (Z=7). 3cje asymmetric unit holds a single chain; however the likely functional form is a dimer, according to PISA.

    According to [Ref], an article describing the structure of a hydroperoxide resistance protein (PDB accession code 1usp), the active site residues consist of two close cysteines, Cys-57 and Cys-121 in PDB entry 1usp, which are conserved in the structure of 3cje and aligned to Cys-72 and Cys-141. This and the Pfam membership underline the functional prediction.


    Ligand Summary

    Tris (TRS) ion and Phosphate (PO4) ion from crystallization condition and glycerol
    (GOL) from cryo condition were modelled.


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
    dimer.png
    No description
    100.26 kB22:04, 30 Jun 2008dweekesActions
    monomer.png
    No description
    164.99 kB22:04, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch