.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cgg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of TehB-like SAM-dependent methyltransferase (NP_600671.1) from Corynebacterium glutamicum ATCC 13032 Kitasato at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3cgg Target Id 372498
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS1612,NP_600671.1, BIG_554, 104095 Molecular Weight 21115.51 Da.
    Residues 194 Isoelectric Point 4.61
    Sequence mttwkeltdnnpahsenyaqrwrnlaaagndiygearlidamaprgakildagcgqgriggylskqghd vlgtdldpilidyakqdfpearwvvgdlsvdqisetdfdlivsagnvmgflaedgrepalanihralga dgravigfgagrgwvfgdflevaervglelenafeswdlkpfvqgseflvavftkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.212
    Matthews' coefficent 2.43 Rfactor 0.167
    Waters 276 Solvent Content 49.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cgg
    1. Tellurite: history, oxidative stress, and molecular mechanisms of resistance
    TG Chasteen, DE Fuentes - FEMS microbiology , 2009 - Wiley Online Library
     
    2. Structure and mechanism of the chalcogen-detoxifying protein TehB from Escherichia coli
    H Choudhury, A Cameron, S Iwata, K Beis - Biochem. J, 2011 - biochemj.org
     

    Protein Summary

    This is the structure of TehB-like SAM-dependent methyltransferase from CORYNEBACTERIUM GLUTAMICUM ATCC 13032 KITASATO. It belongs to Pfam; PF08241; Methyltransf_11; PF08242; Methyltransf_12. Several homologs were found in PDB: e.g. 3c3p, 3bkw, 3bkx, 2r3s, 2qe6 and 2p7i

    There are two molecules (A and B subunits) found in asu. The N-terminal 21 residues of A subunit are very different from those of B subunit as shown in the figure. (N-terminal: Left and Right Top of the structure. Green; A subunit, Cyan: B subunit).  



    Ligand Summary

    2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID(NHE) AND CITRATE (CIT) FROM CRYSTALLIZATION, AND ETHYLENE GLYCOLE (EDO) FROM CRYO SOLUTION WERE MODELED.


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    all.png
    No description
    154.42 kB22:04, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch