.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cec

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative antidote protein of plasmid maintenance system (ZP_00107635.1) from Nostoc punctiforme PCC 73102 at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 3cec Target Id 371811
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1596,NPUN_22DEC03_CONTIG1_REVISED_GENENPF2943, BIG_252, 91758 Molecular Weight 11723.68 Da.
    Residues 103 Isoelectric Point 4.44
    Sequence mdnwqditddrlvrpihpgeviadilddldintanfaeilgvsnqtiqevingqrsitvdiairlgkal gngprlwlnlqqkvdlwyalqshkeeyeqvmtlv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.202
    Matthews' coefficent 2.68 Rfactor 0.166
    Waters 97 Solvent Content 54.14

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Npun_F2943 gene from Nostoc punctiforme pcc 73102 encodes the YP_001866417 protein from the helix-turn-helix group (PF01381).

    3cec structure belongs to the all alpha class, lambda repressor-like DNA-binding domains superfamily from SCOP. According to DALI, this putative antidote protein of plasmid maintenance system is structurally similar to the transcriptional regulator YBAQ PDB:2eby (Z=15), the bacterial antitoxin Higa From E.coli (PDB:2icp; Z=13), the CLP gene regulator PDB:3f51 (Z=9), the DNA-binding domain of the P22 C2 repressor (PDB:1adr; Z=8), and the amino-terminal domain of phage 434 repressor (PDB:1r69; Z=8).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch