.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cea

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of myo-inositol 2-dehydrogenase (NP_786804.1) from Lactobacillus plantarum at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 3cea Target Id 379488
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS1741,NP_786804.1 Molecular Weight 38097.39 Da.
    Residues 345 Isoelectric Point 5.15
    Sequence mvttrkplraaiiglgrlgerharhlvnkiqgvklvaacaldsnqlewaknelgvettytnykdmidte nidaifivaptpfhpemtiyamnaglnvfcekplgldfnevdemakvikshpnqifqsgfmrryddsyr yakkivdngdigkiiymrgygidpisgmesftkfateadsggifvdmnihdidlirwftgqdpvqaygl tsniaapqladigefetgvaqlkmsdgviatliggrhaahgnqvelevmgsngwvrigehpdlnrvtvf ndqgvvrpslqsfgerfdtaftdevqdfvnnvivgkqpevtvddgikalkiakacqqsanigklvdiql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.243
    Matthews' coefficent 2.23 Rfactor 0.193
    Waters 345 Solvent Content 44.84

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This protein, myo-inositol 2-dehydrogenase, belongs to the PFAM family of PF01408; GFO_IDH_MocA. The biomolecule is tetramer. Each monomer has a fold common to Oxidoreductase, but the tetramer orients such that two long sheets form a channel of some sort with helices on either side of the channel. The flanking domain adopts the oxidoreductase fold.

    Fig.1 Tetramer showing one NAD bound to each monomer.

     
    Fig. 2 Two orthogonal views showing a channel formed by beta sheets.

    The monomer has a common fold with several homologs in the PDB (e.g. 2GLX 1OFG 1ZH8 2IXA 2NVW 2P2S 1YDW 1TLT 1GCU 2HO3 1XEA). Of these, 2GLX, 1OFG, 1ZH8 ,2IXA,  2P2S  also have NAD bound to them in identical location.

    Ligand Summary

    NAD is bound to the protein.

    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch