| Title | Crystal structure of myo-inositol 2-dehydrogenase (NP_786804.1) from Lactobacillus plantarum at 2.40 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 379488 | | Molecular Characteristics | | Source | Lactobacillus plantarum wcfs1 | | Alias Ids | TPS1741,NP_786804.1 | Molecular Weight | 38097.39 Da. | | Residues | 345 | Isoelectric Point | 5.15 | | Sequence | mvttrkplraaiiglgrlgerharhlvnkiqgvklvaacaldsnqlewaknelgvettytnykdmidte nidaifivaptpfhpemtiyamnaglnvfcekplgldfnevdemakvikshpnqifqsgfmrryddsyr yakkivdngdigkiiymrgygidpisgmesftkfateadsggifvdmnihdidlirwftgqdpvqaygl tsniaapqladigefetgvaqlkmsdgviatliggrhaahgnqvelevmgsngwvrigehpdlnrvtvf ndqgvvrpslqsfgerfdtaftdevqdfvnnvivgkqpevtvddgikalkiakacqqsanigklvdiql | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.40 | Rfree | 0.243 | | Matthews' coefficent | 2.23 | Rfactor | 0.193 | | Waters | 345 | Solvent Content | 44.84 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
This protein, myo-inositol 2-dehydrogenase, belongs to the PFAM family of PF01408; GFO_IDH_MocA. The biomolecule is tetramer. Each monomer has a fold common to Oxidoreductase, but the tetramer orients such that two long sheets form a channel of some sort with helices on either side of the channel. The flanking domain adopts the oxidoreductase fold.

Fig.1 Tetramer showing one NAD bound to each monomer.

Fig. 2 Two orthogonal views showing a channel formed by beta sheets.
The monomer has a common fold with several homologs in the PDB (e.g. 2GLX 1OFG 1ZH8 2IXA 2NVW 2P2S 1YDW 1TLT 1GCU 2HO3 1XEA). Of these, 2GLX, 1OFG, 1ZH8 ,2IXA, 2P2S also have NAD bound to them in identical location.
Ligand Summary
NAD is bound to the protein.
References