.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cea

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of myo-inositol 2-dehydrogenase (NP_786804.1) from Lactobacillus plantarum at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 3cea Target Id 379488
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS1741,NP_786804.1, 452589 Molecular Weight 38097.39 Da.
    Residues 345 Isoelectric Point 5.15
    Sequence mvttrkplraaiiglgrlgerharhlvnkiqgvklvaacaldsnqlewaknelgvettytnykdmidte nidaifivaptpfhpemtiyamnaglnvfcekplgldfnevdemakvikshpnqifqsgfmrryddsyr yakkivdngdigkiiymrgygidpisgmesftkfateadsggifvdmnihdidlirwftgqdpvqaygl tsniaapqladigefetgvaqlkmsdgviatliggrhaahgnqvelevmgsngwvrigehpdlnrvtvf ndqgvvrpslqsfgerfdtaftdevqdfvnnvivgkqpevtvddgikalkiakacqqsanigklvdiql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.243
    Matthews' coefficent 2.23 Rfactor 0.193
    Waters 345 Solvent Content 44.84

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cea
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Structure-activity relationships in peptide-antibody complexes: implications for epitope prediction and development of synthetic peptide vaccines
    SW Chen, MHV Van Regenmortel - Current medicinal , 2009 - ingentaconnect.com
     
    3. Docking and biomolecular simulations on computer Grids: status and trends
    AA Tantar, S Conilleau, B Parent - -Aided Drug Design, 2008 - ingentaconnect.com
     
    4. Structure and RNA interactions of the plant microRNA processing associated protein HYL1
    RM Rasia, J Mateos, NG Bologna, P Burdisso - Biochemistry, 2010 - ACS Publications
     
    5. A novel _-N-acetylgalactosaminidase family with an NAD+-dependent catalytic mechanism suitable for enzymatic removal of blood group A antigens
    G Sulzenbacher, QP Liu, EP Bennett - Biocatalysis and , 2009 - informahealthcare.com
     
    6. The cell surface proteoglycans syndecan-1 and-4 bind overlapping but distinct sites in the laminin _3 LG45 domain
    S Carulli, K Beck, G Dayan, S Boulesteix - Journal of Biological , 2012 - ASBMB
     
    7. Structural investigation of myo-inositol dehydrogenase from Bacillus subtilis: implications for catalytic mechanism and inositol dehydrogenase subfamily classification
    K van Straaten, H Zheng, D Palmer, D Sanders - Biochem. J, 2010 - biochemj.org
     
    8. Best Abstracts
    C Lenormand, F Gross, H Bausinger, D Fricker - 2011 - Wiley Online Library
     

    Protein Summary

    This protein, myo-inositol 2-dehydrogenase, belongs to the PFAM family of PF01408; GFO_IDH_MocA. The biomolecule is tetramer. Each monomer has a fold common to Oxidoreductase, but the tetramer orients such that two long sheets form a channel of some sort with helices on either side of the channel. The flanking domain adopts the oxidoreductase fold.

    Fig.1 Tetramer showing one NAD bound to each monomer.

     
    Fig. 2 Two orthogonal views showing a channel formed by beta sheets.

    The monomer has a common fold with several homologs in the PDB (e.g. 2GLX 1OFG 1ZH8 2IXA 2NVW 2P2S 1YDW 1TLT 1GCU 2HO3 1XEA). Of these, 2GLX, 1OFG, 1ZH8 ,2IXA,  2P2S  also have NAD bound to them in identical location.

    Ligand Summary

    NAD is bound to the protein.

    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch