.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ccf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative methyltransferase (YP_321342.1) from Anabaena variabilis ATCC 29413 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3ccf Target Id 383249
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1769,YP_321342.1, BIG_666, 88623 Molecular Weight 29240.69 Da.
    Residues 260 Isoelectric Point 5.50
    Sequence mtnlgtaknfwdatlyqdkhsfvwqygedllqllnpqpgefildlgcgtgqltekiaqsgaevlgtdna atmiekarqnyphlhfdvadarnfrvdkpldavfsnamlhwvkepeaaiasihqalksggrfvaefggk gnikyilealynaletlgihnpqalnpwyfpsigeyvnilekqgfdvtyaalfnrpttlaegefgmanw iqmfasaflvgltpdqqvqlirkveatlqdklyhqeswtadyrririvsikaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.219
    Matthews' coefficent 1.97 Rfactor 0.180
    Waters 399 Solvent Content 37.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ccf
    1. Juvenile hormone synthesis:esterify then epoxidize or epoxidize then esterify? Insights from the structural characterization of juvenile hormone acid
    LA Defelipe, E Dolghih, AE Roitberg, M Nouzova - Insect Biochemistry and , 2011 - Elsevier
     
    2. Trm112 is required for Bud23-mediated methylation of the 18S rRNA at position G1575
    S Figaro, L Wacheul, S Schillewaert - and Cellular Biology, 2012 - Am Soc Microbiol
     

    Protein Summary

    The sequence annotation (Genbank  YP_321342) incorrectly describes this protein as cyclopropane-fatty-acyl-phospholipid synthase from Anabaena variabilis ATCC 29413. This protein is likely to be a methyltransferase.

    It has multi domains and belongs to PFAMs PF08241 Methyltransf_11, PF08242 Methyltransf_12, PF02353 CMAS.
    Several homologs exist in the PDB, e.g. 2P35, 1Y8C 1VL5 1RI1 1UFK 2P8J 1VE3 1M6E 2AVN 1QZZ 2FK8 1IM8.

    Benzoic acid was bound to each monomer.



    Ligand Summary

    Benzoic acid

    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    FP2288D.png
    No description
    135.66 kB22:06, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch