.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 3ccf

3ccf

    Page last modified 01:53, 26 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of putative methyltransferase (YP_321342.1) from Anabaena variabilis ATCC 29413 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3ccf Target Id 383249
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1769,YP_321342.1 Molecular Weight 29240.69 Da.
    Residues 260 Isoelectric Point 5.50
    Sequence mtnlgtaknfwdatlyqdkhsfvwqygedllqllnpqpgefildlgcgtgqltekiaqsgaevlgtdna atmiekarqnyphlhfdvadarnfrvdkpldavfsnamlhwvkepeaaiasihqalksggrfvaefggk gnikyilealynaletlgihnpqalnpwyfpsigeyvnilekqgfdvtyaalfnrpttlaegefgmanw iqmfasaflvgltpdqqvqlirkveatlqdklyhqeswtadyrririvsikaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.219
    Matthews' coefficent 1.97 Rfactor 0.180
    Waters 399 Solvent Content 37.54

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The sequence annotation (Genbank  YP_321342) incorrectly describes this protein as cyclopropane-fatty-acyl-phospholipid synthase from Anabaena variabilis ATCC 29413. This protein is likely to be a methyltransferase.

    It has multi domains and belongs to PFAMs PF08241 Methyltransf_11, PF08242 Methyltransf_12, PF02353 CMAS.
    Several homologs exist in the PDB, e.g. 2P35, 1Y8C 1VL5 1RI1 1UFK 2P8J 1VE3 1M6E 2AVN 1QZZ 2FK8 1IM8.

    Benzoic acid was bound to each monomer.



    Ligand Summary

    Benzoic acid

    References

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    • No tags
    What links here
    Attach file or image

    Files (1)

    FileSizeDateAttached by 
    FP2288D.png
    No description
    		135.66 kB22:06, 30 Jun 2008dweekesActions
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch