.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c8u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative fructose transport system kinase (YP_612366.1) from Silicibacter sp. TM1040 at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 3c8u Target Id 377904
    Molecular Characteristics
    Source Silicibacter sp. tm1040
    Alias Ids TPS1697,YP_612366.1, 383176 Molecular Weight 22503.43 Da.
    Residues 207 Isoelectric Point 5.54
    Sequence mtlaalcqgvlerldprqpgrqlvalsgapgsgkstlsnplaaalsaqglpaevvpmdgfhldnrllep rgllprkgapetfdfegfqrlchalkhqerviyplfdrardiaiagaaevgpecrvaiiegnyllfdap gwrdltaiwdvsirlevpmadlearlvqrwldhglnhdaavaraqgndlanaraieaarlpadltwpqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.218
    Matthews' coefficent 2.58 Rfactor 0.165
    Waters 288 Solvent Content 52.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3c8u
    1. _-Galactosidase/Sucrose Kinase (AgaSK), a Novel Bifunctional Enzyme from the Human Microbiome Coupling Galactosidase and Kinase Activities
    L Bruel, G Sulzenbacher, MC Tison, A Pujol - Journal of Biological , 2011 - ASBMB
     

    Protein Summary

    The structure is very similar to 1rz3. It has a well conserved active site pocket (eg K34, S34, T36, D58, E129, R167 etc). The structure consists of a P-loop NTPase base domain decorated with inserts which help to form a fairly large pocket. The GX4GKT P-loop is located at 28-GAPGSGKS-35. According to SCOP annotation, it belongs to Phosphoribulokinase/pantothenate kinase family.

    (CONSURF: magenta=most conserved, cyan=least conserved)

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch