.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c6c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of 3-keto-5-aminohexanoate cleavage enzyme (YP_293392.1) from Ralstonia eutropha JMP134 at 1.72 A resolution. To be published
    Site JCSG
    PDB Id 3c6c Target Id 381418
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS1757,YP_293392.1, PF05853, 86556 Molecular Weight 31990.10 Da.
    Residues 297 Isoelectric Point 5.24
    Sequence msrkviltcavtgnapfnpkhpsmpitpaqiadacveaakagasvahihvrdpktgggsrdpvlfkevv drvrssgtdivlnltcglgafllpdpedeskalpesdvvpvaervkhledclpeiasldittgnqvegk lefvylnttrtlramarrfqelgikpelevfspgdilfgkqlieeglidgvplfqmvlgvlwgapaste tmiyqrnlipanaqwaafgigrdqmpmmaqaallggnvrvglednlylsrgvfatngqlverartvieh lgmsvatpdeardimglsrpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.72 Rfree 0.184
    Matthews' coefficent 2.92 Rfactor 0.153
    Waters 395 Solvent Content 57.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3c6c
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. 3-Keto-5-aminohexanoate Cleavage Enzyme
    M Bellinzoni, K Bastard, A Perret, A Zaparucha - Journal of Biological , 2011 - ASBMB
     
    3. Ligands in crystal structures that aid in functional characterization
    AE Speers, BF Cravatt - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    Gene Reut_C6226 from Ralstonia eutropha jmp134 encodes the YP_293392 protein containing a classical TIM barrel fold. It is the first solved representative of a very large PFAM family PF05853  (prokaryotic family with unknown function DUF849, FFAS score: -107; or COG3246 from the COGs database, FFAS score: -103).  One of the members (CAM07313, 43% seq id) was characterized as a 3-keto-5-aminohexanoate cleavage enzyme that is involved in in the fermentation pathway of lysine (Kreimeyer et al. 2007).  The genome context analysis with the STRING server indicates functional association with Reut_C6225 (a NAD-dependent epimerase/dehydratase), and Reut_C6224 (a short-chain dehydrogenase/reductase).   

    A structural similarity search with DALI gives strong hits with other DUF849 proteins like PDB:3lot, PDB:3e02, PDB:3chv, PDB:3e49 and PDB:3fa5 (Z=39-37). 3c6c biomolecule is likely to be a tetramer. A weaker hit (Z=16) is detected with the pyridoxine 5'-phosphate synthase PDB:3gk0. 3c6c chelates a Ni metal via the side chains of residues H47, H49 and E250. Three ordered water molecules are observed in the vicinity.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    pu6423s-tetra.png
    No description
    234.81 kB22:05, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch