.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c26

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative acetyltransferase (NP_394282.1) from Thermoplasma acidophilum at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3c26 Target Id 376023
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1664,NP_394282.1, 336968 Molecular Weight 30521.85 Da.
    Residues 265 Isoelectric Point 5.31
    Sequence msadivfdrgspsdideiktftsntwkvgyytdlyskladtgtmddyvdkvierwvndgsvyvlrvsgr pvatihmeklpdgsvmlgglrvhpeyrgsrlgmsimqetiqflrgkterlrsavyswnepslrlvhrlg fhqveeypiytfqggstavpalkpvneryagrwrcffidwkymcsddpdiiheeysnnlivdgstfvyf diyeggidlfvndsddassfiekyrsmngritfyvrkalanglpyvpassltvweyry
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.242
    Matthews' coefficent 2.04 Rfactor 0.179
    Waters 150 Solvent Content 39.85

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3c26
    1. Measured and calculated CD spectra of G_quartets stacked with the same or opposite polarities
    DM Gray, JD Wen, CW Gray, R Repges, C Repges - Chirality, 2008 - Wiley Online Library
     
    2. Circular Dichroism Spectra and Electrophoretic Mobility Shift Assays Show That Human Replication Protein A Binds and Melts Intramolecular G-Quadruplex Structures
    JH Fan, E Bochkareva, A Bochkarev, DM Gray - Biochemistry, 2009 - ACS Publications
     
    3. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     

    Protein Summary

    376023 belongs to the acetyltransferase (GNAT) family, which is PF00583. It is structurally similar to other acetyltransferases, including 1b87 as well as the N-acetyl transferase, NAT family from SCOP.

    376023 crystallizes as a monomer, but is predicted to form a dimer in solution.





    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch