The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative oxidoreductase (YP_511008.1) from Jannaschia sp. CCS1 at 1.62 A resolution. To be published
    Site JCSG
    PDB Id 3c24 Target Id 379416
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS1738,YP_511008.1, 104810 Molecular Weight 31029.02 Da.
    Residues 285 Isoelectric Point 4.99
    Sequence mvkdkndvgpktvailgaggkmgaritrkihdsahhlaaieiapegrdrlqgmgipltdgdgwideadv vvlalpdniiekvaedivprvrpgtivlildaaapyagvmperadityfighpchpplfndetdpaart dyhggiakqaivcalmqgpeehyaigadicetmwspvtrthrvtteqlailepglsemvampfvetmvh avdecadrygidrqaaldfmighlnveiamwfgyspkvpsdaalrlmefakdivvkedwrealnpakvk qaaeliagk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.62 Rfree 0.195
    Matthews' coefficent 2.14 Rfactor 0.161
    Waters 565 Solvent Content 42.49

    Ligand Information



    Protein Summary

    JCSG Structure Refinement Summary

    This is a two domain protein; a small domain like FMN binding split barrel protein and a large domain that is largely comprised of helices. The helical domain is also the dimerization domain. The protein does not have a PFAM classification yet, but all the homologs returned by DALI search point it to be an Oxidoreductase. There are several homologs already solved by JCSG.

    According to FFAS, this protein is similar to COG0345: Pyrroline-5-carboxylate reductase (FFAS score: -43.400) and to COG0287: Prephenate dehydrogenase (FFAS score: -43.200).

    Ligand Summary





    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    No description
    48.26 kB22:05, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch