| Title | Crystal structure of a putative oxidoreductase (YP_511008.1) from Jannaschia sp. CCS1 at 1.62 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 379416 | | Molecular Characteristics | | Source | Jannaschia sp. ccs1 | | Alias Ids | TPS1738,YP_511008.1 | Molecular Weight | 31029.02 Da. | | Residues | 285 | Isoelectric Point | 4.99 | | Sequence | mvkdkndvgpktvailgaggkmgaritrkihdsahhlaaieiapegrdrlqgmgipltdgdgwideadv vvlalpdniiekvaedivprvrpgtivlildaaapyagvmperadityfighpchpplfndetdpaart dyhggiakqaivcalmqgpeehyaigadicetmwspvtrthrvtteqlailepglsemvampfvetmvh avdecadrygidrqaaldfmighlnveiamwfgyspkvpsdaalrlmefakdivvkedwrealnpakvk qaaeliagk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.62 | Rfree | 0.195 | | Matthews' coefficent | 2.14 | Rfactor | 0.161 | | Waters | 565 | Solvent Content | 42.49 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
JCSG Structure Refinement Summary
This
is a two domain protein; a small domain like FMN binding split barrel
protein and a large domain that is largely comprised of helices. The
helical domain is also the dimerization domain. The protein does not
have a PFAM classification yet, but all the homologs returned by DALI
search point it to be an Oxidoreductase. There are several homologs
already solved by JCSG.
According to FFAS, this protein is similar to COG0345: Pyrroline-5-carboxylate reductase (FFAS score: -43.400) and to COG0287: Prephenate dehydrogenase (FFAS score: -43.200).
Ligand Summary
References
