.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c1l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative antioxidant defense protein (NP_105057.1) from Mesorhizobium loti at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3c1l Target Id 369153
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS1544,NP_105057.1, 90982 Molecular Weight 20533.35 Da.
    Residues 187 Isoelectric Point 5.44
    Sequence mtgkisaldlasgelseptkayfakceeklglvpnvlkayafddkklraftdiyndlmlgesglskldr emiavavssinhcyycltahgaavrqlsgdpalgemlvmnfraadlsprqtamlefavklteepakive adraalrkagfsdrdiwdiastaaffnmsnrvaaaidmrpndeyhamar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.00 Rfree 0.225
    Matthews' coefficent 2.35 Rfactor 0.171
    Waters 731 Solvent Content 47.66

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene mlr4105 from Mesorhizobium loti translates into the putative antioxidant defense protein (NP_105057.1) that belongs to the CMD group (PF02627). ZP_01012034, annotated as alkylhydroperoxidase family core domain protein, has 70% seq. id. with this target.

    SCOP classifies 3c1l inside the all-alpha class, AhpD-like superfamily, Atu0492-like family. According to DALI, structurally similar proteins to 3c1l are the peroxidase related proteins 2pfx (Z=30) and 2oyo (Z=27), the AhpD core protein 2prr (Z=27), the hypothetical proteins ATU0492 2gmy and PA0269 2o4d (Z=17).

    Cys82, Cys85 (and His89) are predicted to be functionally important for the 3c1l putative peroxidase activity. An interesting article describing CMD proteins and relating them to AhpD proteins is given by [Ref].





    Figure 1: Cross-section o
    f 3c1l structure showing a cleft with the putative active site residues labeled.


    Figure 2: 3c1l hexameric crystal packing.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch