.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c18

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of nucleotidyltransferase-like protein (ZP_00538802.1) from Exiguobacterium sibiricum 255-15 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3c18 Target Id 377609
    Molecular Characteristics
    Source Exiguobacterium sibiricum 255-15
    Alias Ids TPS1690,YP_001813159.1, 382972 Molecular Weight 34079.43 Da.
    Residues 289 Isoelectric Point 6.68
    Sequence meqatrtiyseyaaypetqgiiavekrqprdsltdqfdvlllvitrdpsvewtvkhyrlntlrvslhlv heqvlsrwlilnanrravhwvsegtiiferndyltdlkkqlrnfpeterclqmslsfakllrrfqdgrn lfsrgnyydaythvhhalhhlarlsvlekgahpevvvweqarlddpdvyklyeqlllseetleqrihla liglehllqskvlsggkylfevmrerdrpwtmhelmeesrltelkvdlgslvdffirkglirisyqrtk glgvelvtyepvv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.233
    Matthews' coefficent 2.84 Rfactor 0.183
    Waters 538 Solvent Content 56.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3c18
    1. Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB
    M Morar, K Bhullar, DW Hughes, M Junop, GD Wright - Structure, 2009 - Elsevier
     
    2. Structure of the adenylylation domain of E. coli glutamine synthetase adenylyl transferase: evidence for gene duplication and evolution of a new active site
    Y Xu, PD Carr, SG Vasudevan, DL Ollis - Journal of molecular biology, 2010 - Elsevier
     
    3. 9-Substituted 6, 6-Dimethyl-11-oxo-6, 11-dihydro-5H-benzo [b] carbazoles as Highly Selective and Potent Anaplastic Lymphoma Kinase Inhibitors
    K Kinoshita, T Kobayashi, K Asoh - Journal of medicinal , 2011 - ACS Publications
     
    4. Structure and Function of the Cardiac Stress Response Protein MS1
    CLF Fogl - 2011 - lra.le.ac.uk
     

    Protein Summary

    377609 encondes a hypothetical protein of unknown function with 289 residues. The structure is comprised of three domains. The smaller N-terminal domain (residues 1-113) contains a four stranded beta sheet packed between four helices (shown in orange in figure 1 below). The central domain (residues 114-216) resembles a four-helix bundle, and the C-terminal domain (residues 217-289) with additional helices and a small beta sheet attached, resembles DNA-binding domains (with similarity to PDB:2hzt). The central and C-terminal domains are shown in blue in figure 1 below.


    Figure 1. Monomeric form of 377609, with N-term shown in orange, and c-term in blue.

    Based on a structural comparison with 1KNY, it is possible to get some information about the basic fold for the two domains. Based on SCOP, the N-terminal domain appears to form a nucleotidyltransferase fold, while the C-terminal domain takes a four-helical up-and-down bundle fold. The N-teminal and central domain of 377609 has to be twisted to obtain complete superposition with PDB:1KNY. The putative DNA binding domain of 377609 is absent in protein structure 1KNY.

    The oligomeric form of 377609 is a dimer (figure 2), with 1.5 dimers present the crystallographic
    ASU. The dimer creates a very large cavity, ~10227A3.


    Figure 2. The dimer, with the A chain in blue and the B chain in orange.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch