.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bwx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of an alpha/beta hydrolase (YP_496220.1) from Novosphingobium aromaticivorans DSM 12444 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 3bwx Target Id 387108
    Molecular Characteristics
    Source Novosphingobium aromaticivorans dsm 12444
    Alias Ids TPS1776,YP_496220.1, 291243 Molecular Weight 31438.02 Da.
    Residues 284 Isoelectric Point 4.87
    Sequence maeyedrywtssdglrlhfrayegdisrppvlclpgltrnardfedlatrlagdwrvlcpemrgrgdsd yakdpmtyqpmqylqdleallaqegierfvaigtslgglltmllaaanpariaaavlndvgpevspegl erirgyvgqgrnfetwmhaaralqessgdvypdwditqwlryakrimvlgssgriafdydmkiaepfea pagatpqvdmwplfdalatrpllvlrgetsdilsaqtaakmasrpgvelvtlprighaptldepesiaa igrllerv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.203
    Matthews' coefficent 2.00 Rfactor 0.161
    Waters 336 Solvent Content 38.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bwx
    1. Structure determination and characterization of the vitamin B6 degradative enzyme (E)-2-(acetamidomethylene) succinate hydrolase
    KM McCulloch, T Mukherjee, TP Begley, SE Ealick - Biochemistry, 2010 - ACS Publications
     
    2. Crystal Structure of a Novel Esterase Rv0045c from Mycobacterium tuberculosis
    X Zheng, J Guo, L Xu, H Li, D Zhang, K Zhang, F Sun - PloS one, 2011 - dx.plos.org
     
    3. The unusual extended C-terminal helix of the peroxisomal [alpha]/[beta]-hydrolase Lpx1 is involved in dimer contacts but dispensable for dimerization
    S Thoms, J Hofhuis, C Thing, J Grtner - Journal of structural , 2011 - Elsevier
     

    Protein Summary

    This protein is an alpha/beta hydrolase.  It shares both sequence and structural similarity to other alpha/beta hydrolases according to BLAST (best hit to gi|87198963|ref|YP_496220.1| , E-value: 9e-147), FFAS (best hit to a haloalkane dehalogenase from a Rhodococcus species with score: -76.000, PDB code: 1bn6 ), and DALI (hits to 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from Rhodococcus sp. strain rha1, Z-score: 23.9, RMSD: 3.1, PDB code: 1c4x and a haloalkane dehalogenase at ph 5.0 containing chloride, Z-score: 22.6, RMSD: 2.8, PDB code:1b6g).  1b6g has a catalytic triad composed of Asp124, His289, and Asp260.  The catalytic triad is conserved in this protein and is composed of: Ser105, His 265, and Asp239.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch