.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bos

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title A structural basis for the regulatory inactivation of DnaA. J.Mol.Biol. 385 368-380 2009
    Site JCSG
    PDB Id 3bos Target Id 378832
    Molecular Characteristics
    Source Shewanella amazonensis sb2b
    Alias Ids TPS1727,SAMA_14OCT04_CONTIG53_REVISED_GENE1514 Molecular Weight 26982.58 Da.
    Residues 241 Isoelectric Point 6.07
    Sequence lrsnrvtqhpplqlslpvhlpddetftsyypaagndeligalksaasgdgvqaiylwgpvksgrthlih aacaranelerrsfyiplgihasistallegleqfdliciddvdavaghplweeaifdlynrvaeqkrg slivsasaspmeagfvlpdlvsrmhwgltyqlqpmmddeklaalqrraamrglqlpedvgrfllnrmar dlrtlfdvldrldkasmvhqrkltipfvkemlrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.201
    Matthews' coefficent 2.47 Rfactor 0.166
    Waters 554 Solvent Content 50.11

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Structural Basis of Regulatory Inactivation of DnaA

    Regulatory inactivation of DnaA (RIDA) is an important mechanism for regulating the activity of DnaA to prevent over initiation during bacterial chromosomal replication. RIDA is dependent on protein Hda and the sliding clamp of DNA polymerase III. Hda protein, when bound to the sliding clamp loaded on the duplex DNA, can trigger the transformation of DnaA from the active DnaA-ATP form into the inactive DnaA-ADP form. Hda is homologous to the ATPase region of DnaA and a member of the family of AAA+ ATPases. The crystal structure of dimeric Hda protein from Shewanella Amazonensis SB2B was determined to 1.75 Å by high-throughput protein crystallography. It contains two domains (1-174, 175-241) which correspond to domain III and domain IIIb of DnaA. The arrangement of the two domains in Hda differs dramatically from that of DnaA. Two sliding clamp binding motifs at the N-terminus (13-18) form an antiparallel beta-sheet at the dimer interface and are located on the same face of the dimer. The dimer of Hda demonstrates a new mode of oligomeric assembly of AAA+ proteins in which the two arginine fingers (Arg 161) crucial for the inactivation of DnaA-ATP are fully exposed. One cytidine diphosphate (CDP) molecule was found in the active site of each Hda monomer. CDP is perfered over ADP/UDP by the conserved binding site. This raises the possibility of Hda activity being regulated by CDP (or CTP). Analysis of Walker A and B motifs of Hda  proteins suggests that Hda may have lost its NTPase acitivity. The structure of Hda provides us valuable insights into the regulation of Hda protein as well as the interactions between Hda and the sliding clamp and DnaA.





    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    nt-ecoli.png
    No description
    23.05 kB22:05, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch