.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bn8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative sterol carrier protein 2 (2649030) from Archaeoglobus fulgidus at 2.11 A resolution. To be published
    Site JCSG
    PDB Id 3bn8 Target Id 381893
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS1765,2649030 Molecular Weight 13153.44 Da.
    Residues 116 Isoelectric Point 4.93
    Sequence mseakelikkmcdlqnsneeiqkemagwsgvvqykldgeefyveyksdgtcefkegvhssptftvvapp dfwlavlkgqedpvsgfmmgkyriegnimeaqrlagvikkfqgkfel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.11 Rfree 0.248
    Matthews' coefficent 2.11 Rfactor 0.196
    Waters 68 Solvent Content 41.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bn8
    1. NMR and X-ray structures of the putative sterol carrier protein 2 from Thermus thermophilus HB8 show conformational changes
    AK Goroncy, K Murayama, M Shirouzu - Journal of structural and , 2010 - Springer
     

    Protein Summary

    Gene AF1534 (PF02036, cl01225) from Archaeoglobus fulgidus translates into the protein NP_070363.1 from the SCP2 sterol transfer family (PF02036).  

    Pre-SCOP classifies 3bn8 in the alpha+beta class, sterol carrier protein-like (super)family. A structural similarity search using DALI returns as top hits the estradiol beta-dehydrogenase protein 1ikt (Z=11) and the SCP-2 proteins 1c44, 2qzt and 3bdq (Z=10). In the 3bn8 crystal structure there are 2 monomers in each asymmetric unit. The SEC data and surface interaction calculation results suggest that the likely biomolecule is a dimer. Compared with 1IKT, 3bn8  shares the same fold with a hydrophobic tunnel in the structure. There is an OXN or sterol like electron density in this tunnel which is modeled as an unknown ligand near residue Tyr-45.

     

     
         
     

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch