.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bn7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of dimeric ferredoxin-like protein (NP_421070.1) from Caulobacter crescentus at 1.64 A resolution. To be published
    Site JCSG
    PDB Id 3bn7 Target Id 378287
    Molecular Characteristics
    Source Caulobacter crescentus cb15
    Alias Ids TPS1720,NP_421070.1, 3.30.70.900, 335737 Molecular Weight 11618.87 Da.
    Residues 101 Isoelectric Point 6.90
    Sequence mlfhqvffwlknpgdkadrdkliaglkalkaidviqqlhvgvpaatekrdvvdnsydvselmvfksved qkryrdhpllqkfvadcshlwskvvvydsmsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.64 Rfree 0.233
    Matthews' coefficent 1.96 Rfactor 0.199
    Waters 72 Solvent Content 37.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bn7
    1. Crystal structure and catalytic mechanism of 4-methylmuconolactone methylisomerase
    M Marn, DW Heinz, DH Pieper, BU Klink - Journal of Biological Chemistry, 2009 - ASBMB
     

    Protein Summary

    The CC_2267 gene from Caulobacter crescentus CB15 encodes the NP_421070 amino acid sequence that belongs to the Dabb group (PF07876, cl06768). Currently, its function is unknown but a homolog in a plant, Populus balsamifera, is upregulated when exposed to higher concentrations of salt.

    Its structure, 3bn7, belongs to the alpha+beta class, ferredoxin-like fold, dimeric alpha+beta barrel superfamily, plant stress induce protein family (cf. SCOP, CATH). Proteins belonging to this family adopt an alpha/beta barrel (also known as a 2 layer sandwich) with an internal duplication. 3bn7 protein fold is also found in other PSI determined bacterial protein structures like 3bde (Dali Zscr=13; with sequence identity of 26%), 3bgu (Z=12), 2qyc (Z=12), 3bb5 (Zscr=12), and 3fmb (Zscr=12; sequence identity 22%). DALI top hit is with 1tr0 (Z=15).

    The likely biologically functional unit of 3bn7 is a dimer.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch