.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bm7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_420935.1) from Caulobacter crescentus at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 3bm7 Target Id 378310
    Molecular Characteristics
    Source Caulobacter crescentus cb15
    Alias Ids TPS1725,NP_420935.1, 3.30.70.900, 335700 Molecular Weight 10248.37 Da.
    Residues 96 Isoelectric Point 5.65
    Sequence migvvatlkvqpakaaefekvfldlaakvkanepgclvyqltrskteegvykvlelyasmdalkhhggt dyfkaagaamgptmagapvieyldave
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.209
    Matthews' coefficent 2.29 Rfactor 0.189
    Waters 121 Solvent Content 46.27

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The CC_2132 (NP_420935.1) gene from Caulobacter crescentus encodes a protein that belongs to the ABM (antibiotic monooxygenase) family (PF03992 ). The structure adopts a ferredoxin-like fold that belongs to the dimeric alpha+beta barrel superfamily. Most of the homologues from DALI search are hypothetical protein with unknown function. CC_2132 has been directly compared with 2OMO, 1LQ9 and 1N5Q. CC_2132 is a monomer in each asymmetric unit. Based on the interface calculation with/without the tag at the N-terminal, it should be a dimer as the biomolecule. 

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch