.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bln

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of acetyltransferase GNAT family (NP_981174.1) from Bacillus cereus ATCC 10987 at 1.31 A resolution. To be published
    Site JCSG
    PDB Id 3bln Target Id 379032
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS1729,NP_981174.1, 92087 Molecular Weight 16080.25 Da.
    Residues 142 Isoelectric Point 5.89
    Sequence mknvtkasiddldsivhididvigndsrrnyikhsidegrcvivkednsisgfltydtnffdctflsli ivsptkrrrgyassllsymlshsptqkifsstnesnesmqkvfnangfirsgivenldegdpeiifytk klra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.31 Rfree 0.173
    Matthews' coefficent 2.22 Rfactor 0.137
    Waters 186 Solvent Content 44.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bln
    1. Human Naa50p (Nat5/San) Displays Both Protein N_-and N_-Acetyltransferase Activity
    R Evjenth, K Hole, OA Karlsen, M Ziegler - Journal of Biological , 2009 - ASBMB
     

    Protein Summary

    The BCE_4881 gene from Bacillus cereus ATCC 10987 encodes for a GCN5-related N-acetyltransferases (GNAT). See 2q0y for more information.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch