| Title | Crystal structure of acetyltransferase GNAT family (NP_981174.1) from Bacillus cereus ATCC 10987 at 1.31 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 379032 | | Molecular Characteristics | | Source | Bacillus cereus atcc 10987 | | Alias Ids | TPS1729,NP_981174.1 | Molecular Weight | 16080.25 Da. | | Residues | 142 | Isoelectric Point | 5.89 | | Sequence | mknvtkasiddldsivhididvigndsrrnyikhsidegrcvivkednsisgfltydtnffdctflsli ivsptkrrrgyassllsymlshsptqkifsstnesnesmqkvfnangfirsgivenldegdpeiifytk klra | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.31 | Rfree | 0.173 | | Matthews' coefficent | 2.22 | Rfactor | 0.137 | | Waters | 186 | Solvent Content | 44.54 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The BCE_4881 gene from Bacillus cereus ATCC 10987 encodes for a GCN5-related N-acetyltransferases (GNAT). See 2q0y for more information.
Ligand Summary
References
