| Title | Crystal structure of cyclopropane-fatty-acyl-phospholipid synthase-like protein (YP_807781.1) from Lactobacillus casei ATCC 334 at 1.85 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 379434 | | Molecular Characteristics | | Source | Lactobacillus casei atcc 334 | | Alias Ids | YP_807781.1 | Molecular Weight | 29664.93 Da. | | Residues | 274 | Isoelectric Point | 5.02 | | Sequence | mekrldyitdlmalgptanartiqrrqtahrlaiaeawqvkpgekileigcgqgdlsavladqvgssghv tgidiaspdygapltlgqawnhllagplgdrltvhfntnlsddlgpiadqhfdrvvlahslwyfasana lallfknmaavcdhvdvaewsmqptaldqighlqaamiqgllyaiapsdvanirtlitpdtlaqiahdn twtytagtivedptlddahweiattnalltelklstdlrdrvkplleamshngtaslatftgritf | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.85 | Rfree | 0.242 | | Matthews' coefficent | 2.22 | Rfactor | 0.185 | | Waters | 493 | Solvent Content | 44.57 |
| Ligand Information | | Ligands | | | Metals | CL (CHLORIDE) x 1 | | |
Protein Summary
Cyclopropane-fatty-acyl-phospholipid
synthase-like protein (YP_807781.1) has strong similarity to
SAM-dependent methyltransferases. Cofactor binding (carbonate-ion)
residues, such as His129, Trp159, and Glu158 (predicted) are required
for methylene transfer activity.
May be functionally associated with fatty-acid desaturase.
Ligand Summary
References
