.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bkw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of S-adenosylmethionine dependent methyltransferase (NP_104914.1) from Mesorhizobium loti at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 3bkw Target Id 379544
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS1744,NP_104914.1, 104890 Molecular Weight 27044.23 Da.
    Residues 242 Isoelectric Point 5.79
    Sequence maqniydqpdffagysqlgrsiegldgaaewpalramlpevgglrivdlgcgfgwfcrwahehgasyvl gldlsekmlararaagpdtgityeradldklhlpqdsfdlaysslalhyvedvarlfrtvhqalspggh fvfstehpiymaparpgwaidaegrrtwpidrylvegprktdwlakgvvkhhrtvgttlnalirsgfai ehveefcptdaqitarpelaeeldrpmfllvsarr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.200
    Matthews' coefficent 2.21 Rfactor 0.171
    Waters 487 Solvent Content 44.41

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The Mll3908 gene (PF08241 ,cd02440,cl12011) from Mesorhizobium loti MAFF303099 encodes for a methyltransferase (EC:2.1.1.12) which utilizes S-adenosylmethionine (SAM) as a donor for a methyl group to be added either at some nitrogen, oxygen or carbon atom. The structure adopts a Rossman fold (cf. SCOP, CATH). It is interesting to notice that this type of enzyme is also dependent on Mn2++ or Zn2++. Structurally similar proteins determined by the PSI include 3g5l (43% sequence identity over 203 structurally aligned residues, results obtained by TopMatch), 1vl5, 1xxl and many more since Rossman folds are very abundant.

    Todo: Possible improvement of this annotation: Do these Mn/Zn ions appear in the electron density?

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch