.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bhq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of TetR-family transcriptional regulator (NP_105615.1) from Mesorhizobium loti at 1.54 A resolution. To be published
    Site JCSG
    PDB Id 3bhq Target Id 379524
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS1743,NP_105615.1, _0056.000395_, _0052.004968_, 91578 Molecular Weight 23355.59 Da.
    Residues 210 Isoelectric Point 6.85
    Sequence mkidgetrsarkdreiiqaataafiskgydgtsmeeiatkagaskqtvykhftdketlfgevvlstasq vndiiesvttllseaifmegglqqlarrliavlmdeellklrrliianadrmpqlgrawyekgfermla stascfqkltnrgliqtgdpylaashlfgmllwipmneamftgsnrrskaelerhadasveaflavygv qpk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.54 Rfree 0.194
    Matthews' coefficent 2.62 Rfactor 0.173
    Waters 436 Solvent Content 52.98

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene mlr4833 from Mesorhizobium loti encodes the NP_105615 protein, a putative TetR-family transcriptional regulator.  FFAS detects sequence similarity to the TetR_N family (PF00440) from Pfam (FFAS score -26.900) and the Tetracyclin repressor-like, N-terminal domain family from SCOP (FFAS score -36.700). According to DALI, 3bhq is structurally similar to: putative transcriptional repressor (TetrACRR FAMILY) (PDB code: 3c2b, Zscr=18; 1T33, Zscr=16), a Tetr Family Repressor (PDB code: 1T56, Zscr=15), the multidrug binding transcriptional regulator Qacr (PDB code:1jty, Zscr=14), the transcriptional regulator Sco5951 (PDB code:2id3, Zscr=15), and a transcriptional regulator (Rha1_ro04179) (PDB code:2np5, Zscr=11).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch