| Title | Crystal structure of dimeric ferredoxin-like protein of unknown function (YP_288824.1) from Thermobifida fusca YX at 1.50 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 378307 | | Molecular Characteristics | | Source | Thermobifida fusca yx | | Alias Ids | TPS1724,YP_288824.1 | Molecular Weight | 10535.37 Da. | | Residues | 97 | Isoelectric Point | 4.67 | | Sequence | mgirhialfrwndtvtpdqveqvitalsklpaaipelknyafgadlglaagnydfavvadldgedgfra yqdhpdhraalaiiapmladrvavqfal | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.50 | Rfree | 0.237 | | Matthews' coefficent | 2.22 | Rfactor | 0.197 | | Waters | 180 | Solvent Content | 44.63 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The Tfu_0763 gene from Thermobifida fusca YX-ER1 encodes the YP_288824 amino acid sequence that belongs to the stress responsive alpha/beta barrel domain family Dabb (PF07876).
Pre-SCOP classifies 3bgu in the alpha+beta class, ferredoxin-like fold, dimeric alpha+beta barrel superfamily, plant stres induced protein family. DALI top hits for a 3bgu search are with PDB:3bn7, PDB:1tr0 and PDB:1si9 (Z=13), ferredoxin-like protein PDB:2qyc (Z=13), stress responsive protein PDB:3bb5 (Z=12), and the At3g_17210 protein from A. thaliana PDB:1q4r (Z=12).
See 3bn7 for more information.
Ligand Summary
References