.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bgu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of dimeric ferredoxin-like protein of unknown function (YP_288824.1) from Thermobifida fusca YX at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 3bgu Target Id 378307
    Molecular Characteristics
    Source Thermobifida fusca yx
    Alias Ids TPS1724,YP_288824.1, 3.30.70.900, 343298 Molecular Weight 10535.37 Da.
    Residues 97 Isoelectric Point 4.67
    Sequence mgirhialfrwndtvtpdqveqvitalsklpaaipelknyafgadlglaagnydfavvadldgedgfra yqdhpdhraalaiiapmladrvavqfal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.237
    Matthews' coefficent 2.22 Rfactor 0.197
    Waters 180 Solvent Content 44.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bgu
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     
    3. Quantifying instrument errors in macromolecular X-ray data sets
    K Diederichs - Acta Crystallographica Section D: Biological , 2010 - scripts.iucr.org
     
    4. Crystal structure and catalytic mechanism of 4-methylmuconolactone methylisomerase
    M Marn, DW Heinz, DH Pieper, BU Klink - Journal of Biological Chemistry, 2009 - ASBMB
     

    Protein Summary

    The Tfu_0763 gene from Thermobifida fusca YX-ER1 encodes the YP_288824 amino acid sequence that belongs to the stress responsive alpha/beta barrel domain family Dabb (PF07876).

    Pre-SCOP classifies 3bgu in the alpha+beta class, ferredoxin-like fold, dimeric alpha+beta barrel superfamily, plant stres induced protein family. DALI top hits for a 3bgu search are with PDB:3bn7, PDB:1tr0  and PDB:1si9 (Z=13), ferredoxin-like protein PDB:2qyc (Z=13), stress responsive protein PDB:3bb5 (Z=12), and the At3g_17210 protein from A. thaliana PDB:1q4r (Z=12).

     

     

     

    See 3bn7 for more information.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch