The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of biotin protein ligase-like protein of unknown function (YP_612389.1) from Silicibacter sp. TM1040 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3bfm Target Id 377806
    Molecular Characteristics
    Source Silicibacter sp. tm1040
    Alias Ids TPS1693,YP_612389.1, 104651 Molecular Weight 25026.92 Da.
    Residues 234 Isoelectric Point 4.35
    Sequence msetitfpplmtgeaagpgqdpfdlacqkaelgvdaglvvyelgtdvlraalvlapevplakamamlpv cgvgfqnalgalappevavhldwngalringarcgrlriaastddpdtqpdwlvvgldlplwpegdgge tpdetalyaegcadvaaprlleswarhclhwinrwdegeletihgewrglahgmgearteagrsgtflg vdedfgmllrdettthliplttvlvqd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.226
    Matthews' coefficent 2.19 Rfactor 0.179
    Waters 169 Solvent Content 43.80

    Ligand Information


    Google Scholar output for 3bfm
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org

    Protein Summary

    The fold of this structure is very similar to biotin-[acetyl-CoA-carboxylase] ligase. However, there is one significant difference between this structure and all other known structural homologs, this structure does not have so called (b2-b3) insertion (between 43-47) loop which is essential for substrate binding. In many structures with no substrate bound, this loop is flexible. As a result of lacking this loop, the binding site is becoming fully exposed to solvent. Additionally, the essential residues near the biotin binding site are not conserved in this protein. This suggests that FM11526A may have some new function despite a well defined known fold.

    Maybe a dimer, but the dimer is not conserved in structural homologs.

    Sequence alignment between YP_612389.1 and its homologs:
    ZP_01442737 -LAFPPLLWGEAVS---TDA
    ZP_00948748 SPVFPPLLTGAQA----EDP
    EBF52230 -----------------EDP
    ZP_00959145 -LTLPPLMWGEAVP---GDA
    ZP_01748741 -LAFPPAMFGEKVDG---DP
    ECN28793 -----------------------------L
    ZP_01749978 --------------------
    Consensus/95% ....................h..A...t..sh-sGhlha......h.stllbsP-h.L.pAh.hh.hs.htb.ptLGsLtPPElshab.Wss.bblNtt.

    ECZ95388 M
    Consensus/95% sG.h.h.tss......PpWllhthpl.b........G..Pp.T.L..EGC..l.s..llEtas+H.b.hls.a.......lb..W..b.s..hGp.....

    ZP_01058811 NG---AS
    ZP_01904194 SG---RT
    ZP_01755469 QG---IE
    ZP_01743189 KG---LK
    ZP_01035295 NG---LT
    ZP_01442737 DG---LT
    EDG76557 KD---SNAV
    YP_167041 AN---CT
    ZP_00948748 GD---LT
    ZP_01549178 DG---TS
    YP_683117 HG---LT
    EBF52230 SG---LH
    ZP_01735773 YP---KP
    ZP_00959145 TD(5)QT
    ZP_01893656 LP---KP
    ZP_01748741 DG---RT
    EDA78152 YP---KQ
    EDJ18898 -----EG
    ECN28793 NG---HN
    ZP_01749978 SD---LT
    ECZ46228 YP---KN
    ECW00844 AP---AS
    EBF28169 LG---RT
    ECZ95388 EE---FK
    Consensus/95% .......G.a.GhD-.h.bLl+p.....p...........

    Superposition  between  protein structure of YP_612389.1 (cartoon representation) and biotin protein ligase (blue ribbon, PDB code 1wnl). Please note, the position of (non-conserved) Arg102 in YP_612389.1 (cyan stick) is similar to that of catalytic Lys111 of biotin protein ligase (blue stick; PDB code 1wnl; Bagautdinov et al. 2005):


    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    No description
    120.62 kB22:04, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch