| Title | Crystal structure of putative ribokinase (10640157) from Thermoplasma acidophilum at 1.91 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 381882 | | Molecular Characteristics | | Source | Thermoplasma acidophilum dsm 1728 | | Alias Ids | TPS1763,10640157 | Molecular Weight | 32631.34 Da. | | Residues | 287 | Isoelectric Point | 6.21 | | Sequence | mrflayfghlnidvlisvdsipregsvnvkdlrprfggtagnfaivaqkfripfdlysavgmkthreyl amiesmgintghvekfedesgpicyiatdgkkqvsfmhqgamaawapqladeyeyvhfstgpnyldmak sirskiifdpsqeihkyskdelkkfheisymsifndheyrvfremtglsspkvttivtngergsslfmd gkkydfpaipssgdtvgagdsfraglylalynrrsiekgmiygtiiahhviddgienfslnmedleret enyrrmftkrs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.91 | Rfree | 0.245 | | Matthews' coefficent | 2.08 | Rfactor | 0.202 | | Waters | 214 | Solvent Content | 40.90 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The gene NP_394339 from Thermoplasma acidophilum a putative pfkB family carbohydrate kinase PF00294, a ribokinase-like subgroup A. The enzyme belongs to the alpha and beta (a+b) class of proteins and adopts a ribokinase-like fold type SCOP53612. The structure of homologous ribokinase from E.Coli in complex with ribose and ADP is available 1RKD.
Ligand Summary
References
