.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bf5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative ribokinase (10640157) from Thermoplasma acidophilum at 1.91 A resolution. To be published
    Site JCSG
    PDB Id 3bf5 Target Id 381882
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1763,10640157, 3.40.1190.20 Molecular Weight 32803.58 Da.
    Residues 287 Isoelectric Point 6.38
    Sequence mrflayfghlnidvlisvdsipregsvnvkdlrprfggtagnfaivaqkfripfdlysavgmkthreyl amiesmgintghvekfedesgpicyiatdgkkqvsfmhqgamekwkpqladeyeyvhfstgpnyldmak sirskiifdpsqeihkyskdelkkfheisymsifndheyrvfremtglsspkvttivtngergsslfmd gkkydfpaipssgdtvgagdsfraglylalynrrsiekgmiygtiiahhviddgienfslnmedleret enyrrmftkrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.91 Rfree 0.245
    Matthews' coefficent 2.08 Rfactor 0.202
    Waters 214 Solvent Content 40.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bf5
    1. Structural mechanism of C-type inactivation in K+ channels
    LG Cuello, V Jogini, DM Cortes, E Perozo - Nature, 2010 - nature.com
     

    Protein Summary

    The gene NP_394339 from Thermoplasma acidophilum a putative pfkB family carbohydrate kinase PF00294, a ribokinase-like subgroup A.  The enzyme belongs to the alpha and beta (a+b) class of proteins and adopts a ribokinase-like fold type SCOP53612.  The structure of homologous ribokinase from E.Coli in complex with ribose and ADP is available 1RKD

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch