.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bem

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative nitroreductase ydfN (2632848) from Bacillus subtilis at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 3bem Target Id 381891
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS1764,2632848, 3.40.109.10 Molecular Weight 23557.76 Da.
    Residues 206 Isoelectric Point 5.66
    Sequence maefthlvnerrsasnflsghpitkedlnemfelvalapsafnlqhtkyvtvldqdvkeklkqaangqy kvvsssavllvlgdkqayqqaadiyeglkvlgilnkqeydhmvqdtvsfyenrgeqfkrdeairnasls ammfmlsakekgwdtcpmigfdaeavkrilniddqfevvmmitigkektesrrprgyrkpvnefveym
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.175
    Matthews' coefficent 2.14 Rfactor 0.151
    Waters 338 Solvent Content 42.48

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The ydfN gene from Bacillus subtilis encodes a putative nitroreductase (PF00881, COG0778) that adopts an FMN-dependent reductase-like fold and shows strong similarity to other homologs with structures determined by structural genomics (e.g. PDB id: 2B67, FATCAT P-value 5.66e-15). For more details on the structure and function of this enzyme, see [Ref].

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch