.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bdv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of YdeN-like protein of unknown function (DUF1234) (YP_051181.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 1.66 A resolution. To be published
    Site JCSG
    PDB Id 3bdv Target Id 379345
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS1736,YP_051181.1 Molecular Weight 21802.56 Da.
    Residues 190 Isoelectric Point 5.08
    Sequence mqtteidlrltevsqqltmvlvpglrdsddehwqshwerrfphwqrirqrewyqadldrwvlairrels vctqpvilighsfgalaachvvqqgqegiagvmlvapaepmrfeiddriqasplsvptltfashndplm sftraqywaqawdselvdvgeaghinaeagfgpweyglkrlaefseilipnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.66 Rfree 0.213
    Matthews' coefficent 1.96 Rfactor 0.170
    Waters 300 Solvent Content 37.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The ECA3091 gene from Erwinia carotovora atroseptica scri1043 encodes the YP_051181, a member of the DUF1234 group (PFAM:PF06821 COG:COG3545).

    3bdv structure adopts an alpha/beta hydrolase fold (SUNID:53473) and superfamily inside the alpha/beta class. According to DALI, 3bdv shows significant similarity to other homolog structures determined by structural genomics (PDB id: PDB:2qjw [Z=17], PDB:1uxo [Z=19], PDB:2i3d [Z=14], PDB:2gs9, and others annotated as esterases (Z=16) like PDB:1tqh, PDB:1r1d and PDB:1zoi.

    Analysis performed on a homologous and structurally similar hydrolase suggests this protein might be an esterase/lipase active on a soluble ester or small lipid [Ref].

    Ligand Summary


    References

    Reviews

    References

     

    1. Yang CY, Chin KH, Chou CC, Wang AH, and Chou SH Structure of XC6422 from Xanthomonas campestris at 1.6 A resolution: a small serine alpha/beta-hydrolase. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2006 Jun 1; 62(Pt 6):498-503 PubMed HubMed doi:10.1107/S1744309106016265 pmid:16754966.

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch