| Title | Crystal structure of YdeN-like protein of unknown function (DUF1234) (YP_051181.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 1.66 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 379345 | | Molecular Characteristics | | Source | Erwinia carotovora subsp. atroseptica scri1043 | | Alias Ids | TPS1736,YP_051181.1 | Molecular Weight | 21802.56 Da. | | Residues | 190 | Isoelectric Point | 5.08 | | Sequence | mqtteidlrltevsqqltmvlvpglrdsddehwqshwerrfphwqrirqrewyqadldrwvlairrels vctqpvilighsfgalaachvvqqgqegiagvmlvapaepmrfeiddriqasplsvptltfashndplm sftraqywaqawdselvdvgeaghinaeagfgpweyglkrlaefseilipnr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.66 | Rfree | 0.213 | | Matthews' coefficent | 1.96 | Rfactor | 0.170 | | Waters | 300 | Solvent Content | 37.15 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The ECA3091 gene from Erwinia carotovora atroseptica scri1043 encodes the YP_051181, a member of the DUF1234 group (PFAM:PF06821 COG:COG3545).
3bdv structure adopts an alpha/beta hydrolase fold (SUNID:53473) and superfamily inside the alpha/beta class. According to DALI, 3bdv shows significant similarity to other homolog structures determined by structural genomics (PDB id: PDB:2qjw [Z=17], PDB:1uxo [Z=19], PDB:2i3d [Z=14], PDB:2gs9, and others annotated as esterases (Z=16) like PDB:1tqh, PDB:1r1d and PDB:1zoi.
Analysis performed on a homologous and structurally similar hydrolase suggests this protein might be an esterase/lipase active on a soluble ester or small lipid [Ref].
Ligand Summary
References