.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bdi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of predicted CIB-like hydrolase (NP_393672.1) from Thermoplasma acidophilum at 1.45 A resolution. To be published
    Site JCSG
    PDB Id 3bdi Target Id 388819
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1779,NP_393672.1, 383155 Molecular Weight 23053.26 Da.
    Residues 206 Isoelectric Point 8.65
    Sequence malqeefidvngtrvfqrkmvtdsnrrsialfhgysftsmdwdkadlfnnyskigynvyapdypgfgrs assekygidrgdlkhaaefirdylkangvarsvimgasmgggmvimttlqypdivdgiiavapawvesl kgdmkkirqktllvwgskdhvvpialskeyasiisgsrleivegsghpvyikkpeefvritvdflrnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.189
    Matthews' coefficent 2.17 Rfactor 0.163
    Waters 203 Solvent Content 43.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bdi
    1. Structural and functional characterization of a promiscuous feruloyl esterase (Est1E) from the rumen bacterium Butyrivibrio proteoclasticus
    DC Goldstone, SG Villas_Bas, M Till - Proteins: Structure, , 2010 - Wiley Online Library
     

    Protein Summary

    NP_393672.1 has been assigned as hydrolase belong to alpha/beta superfamily from PSCA.  There is no Pfam assignment available for this target at PSCA and Pfam site.   There is a lot of structural homolog to this target based on Dali search results.NP_393672.1 has been directly compared with 1CRT, 1MT3, 1BRT, 1Q0R, 1WOM, 1Y37. The catalytic triad: Ser, Asp and His, has been identified in the structural. No SEC data is available for this target. Based on interface interaction calculation, it should be a monomer.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch