.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 3bdi

3bdi

    Page last modified 02:03, 26 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of predicted CIB-like hydrolase (NP_393672.1) from Thermoplasma acidophilum at 1.45 A resolution. To be published
    Site JCSG
    PDB Id 3bdi Target Id 388819
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1779,NP_393672.1 Molecular Weight 23054.20 Da.
    Residues 206 Isoelectric Point 6.92
    Sequence malqeefidvngtrvfqrkmvtdsnrrsialfhgysftsmdwdkadlfnnyskigynvyapdypgfgrs assekygidrgdlkhaaefirdylkangvarsvimgasmgggmvimttlqypdivdgiiavapawvesl kgdmkkirqktllvwgskdhvvpialskeyasiisgsrleivegsghpvyiekpeefvritvdflrnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.189
    Matthews' coefficent 2.17 Rfactor 0.163
    Waters 203 Solvent Content 43.32

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    NP_393672.1 has been assigned as hydrolase belong to alpha/beta superfamily from PSCA.  There is no Pfam assignment available for this target at PSCA and Pfam site.   There is a lot of structural homolog to this target based on Dali search results.NP_393672.1 has been directly compared with 1CRT, 1MT3, 1BRT, 1Q0R, 1WOM, 1Y37. The catalytic triad: Ser, Asp and His, has been identified in the structural. No SEC data is available for this target. Based on interface interaction calculation, it should be a monomer.

    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch