The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of domain of unknown function with a ferredoxin-like fold (NP_106155.1) from Mesorhizobium loti at 1.79 A resolution. To be published
    Site JCSG
    PDB Id 3bde Target Id 378291
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS1721,NP_106155.1,, 336077 Molecular Weight 11872.01 Da.
    Residues 101 Isoelectric Point 6.64
    Sequence mirhtvvftlkhashsleekrflvdakkilsairgvthfeqlrqispkidyhfgfsmefadqaaytryn dhpdhvafvrdrwvpevekfleidyvplgsvv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.79 Rfree 0.224
    Matthews' coefficent 2.00 Rfactor 0.177
    Waters 253 Solvent Content 38.53

    Ligand Information


    Google Scholar output for 3bde
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. A discrete view on fold space
    MJ Sippl, SJ Suhrer, M Gruber, M Wiederstein - Bioinformatics, 2008 - Oxford Univ Press
    3. Crystal structure and catalytic mechanism of 4-methylmuconolactone methylisomerase
    M Marn, DW Heinz, DH Pieper, BU Klink - Journal of Biological Chemistry, 2009 - ASBMB

    Protein Summary

    Gene mll5499 from Mesorhizobium loti encodes protein NP_106155 with primary sequence similarity to the Dabb family (PF07876).

    3bde structure shows a ferredoxin-like fold belonging to the dimeric alpha+beta barrel superfamily from SCOP.

    DALI top hit using 3bde as query is with the ferredoxin-like protein 3bn7 (Z-scr=14).

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch