The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative multiple antibiotic-resistance repressor (MarR) (ZP_00875883.1) from Streptococcus suis 89/1591 at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 3bdd Target Id 378153
    Molecular Characteristics
    Source Streptococcus suis 98hah33
    Alias Ids TPS1712,SSUI_28JUL04_CONTIG175_REVISED_GENE346, _0036.001110_, 335797 Molecular Weight 16279.93 Da.
    Residues 141 Isoelectric Point 5.80
    Sequence mqemedllyrlkvadetisnlfekqlgisltrysilqtllkdaplhqlalqerlqidraavtrhlklle esgyiirkrnpdnqrevlvwpteqarealitnpsahhqaiktsmnqiltveeseqflatldklliglqn lpi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.275
    Matthews' coefficent 2.47 Rfactor 0.223
    Waters 224 Solvent Content 50.18

    Ligand Information


    Google Scholar output for 3bdd
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org

    Protein Summary

    The SSU05_1136 gene from Streptococcus suis 89-1591 encodes a multiple-antibiotic resistance (MAR) transcription regulator (PF01047, COG1846), adopts a DNA/RNA-binding 3-helical bundle fold and shows strong structural similarity (Dali Zscr=13; FATCAT P-value 3.77e-11) to other putative transcriptional regulators (e.g. 2NNN, 3gf2, 3bj6, 1z91). For more information on the structure and function of this protein family, see [Ref].

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch