The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of domain of unknown function with a RmlC-like cupin fold (NP_887725.1) from Bordetella bronchiseptica at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 3bcw Target Id 379020
    Molecular Characteristics
    Source Bordetella bronchiseptica rb50
    Alias Ids TPS1728,NP_887725.1,, 92106 Molecular Weight 13334.32 Da.
    Residues 122 Isoelectric Point 6.18
    Sequence mpqhdksrlvridtgpminpvagkpsrpiagdasfrtvtafeggqgkvesgvwestsgsfqsnttgyie ychiiegearlvdpdgtvhavkagdafimpegytgrwevdrhvkkiyfvthla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.201
    Matthews' coefficent 2.56 Rfactor 0.167
    Waters 338 Solvent Content 51.87

    Ligand Information


    Google Scholar output for 3bcw
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org

    Protein Summary

    Gene BB1179 from Bordetella bronchiseptica encodes the NP_887725 protein that belongs to the DUF861 group (PF05899) and folds into a RmlC-like cupin fold. 

    Structurally, according to DALI, 3bcw is quite similar to 3es4 (Z=15) and to another structure solved by JCSG: a putative acetyl/propionyl-CoA carboxylase, alpha subunit (ZP_00243239.1) from Rubrivivax gelatinosus PM1 (PDB code: 2o1q; Z=12).  However, 3bcw and 2o1q only share 6.2% sequence identity.  3bcw structure is also similar to yet another JCSG structure: a novel Thermotoga maritima enzyme (TM1112) from the cupin family (PDB code: 1o5u; Z=10).  While the similar regions of these two proteins are shorter (FFAS aligns residues 43-119 of this structure to residues 20-95 of 1o5u, FATCAT aligns residues 50-120 from this structure to residues 21-95 from 1o5u), there is much more sequence conservation (26% in the FFAS alignment and 28.57% in the FATCAT alignment).

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch