.
The Open Protein Structure Annotation Network
PDB Keyword
.
 

3bby

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of glutathione S-transferase (NP_416804.1) from Escherichia coli K12 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 3bby Target Id 379351
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids NP_416804.1 Molecular Weight 24324.40 Da.
    Residues 214 Isoelectric Point 5.27
    Sequence mskpaitlwsdahffspyvlsawvalqekglsfhiktidldsgehlqptwqgygqtrrvpllqiddfels essaiaeyledrfapptweriypldlenrararqiqawlrsdlmpireerptdvvfagakkapltaegk asaeklfamaehllvlgqpnlfgewciadtdlalminrlvlhgdevperlvdyatfqwqrasvqrfial sakqsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.195
    Matthews' coefficent 2.64 Rfactor 0.158
    Waters 230 Solvent Content 53.46

    Ligand Information
    Ligands ACT (ACETATE) x 1;ETX (2-ETHOXYETHANOL) x 2
    Metals CA (CALCIUM) x 2

    Jmol

    Protein Summary

    The yfcF from Escherichia coli k12encodes glutathione S-transferase (subfamily 4).

    This structure is structural and sequentially homologous to Glutathione S-transferase (GST, eg 6gss) 

    The A71 (glu) is important by structural alignment, also A71 is a clearly defined Ramachandran outlier. It is interesting to note that 40-57 is disordered, this seems to correlate with empty active site, it is likely that this segment is important for substrate binding.

    PFAM entry http://pfam.sanger.ac.uk/family?acc=PF02798

    Putative catalytic tyrosine is Tyr18.  The additional analysis needs to be done to confirm Arg58 role in GSH binding.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.

    ABOUT SSL CERTIFICATES
    All content on this site is licensed under a Creative Commons Attribution 3.0 License