| Title | Crystal structure of glutathione S-transferase (NP_416804.1) from Escherichia coli K12 at 1.85 A resolution. | | Site | JCSG | | PDB Id | | Target Id | 379351 | | Molecular Characteristics | | Source | Escherichia coli k12 | | Alias Ids | NP_416804.1 | Molecular Weight | 24324.40 Da. | | Residues | 214 | Isoelectric Point | 5.27 | | Sequence | mskpaitlwsdahffspyvlsawvalqekglsfhiktidldsgehlqptwqgygqtrrvpllqiddfels essaiaeyledrfapptweriypldlenrararqiqawlrsdlmpireerptdvvfagakkapltaegk asaeklfamaehllvlgqpnlfgewciadtdlalminrlvlhgdevperlvdyatfqwqrasvqrfial sakqsg | | | BLAST FFAS |
| Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.85 | Rfree | 0.195 | | Matthews' coefficent | 2.64 | Rfactor | 0.158 | | Waters | 230 | Solvent Content | 53.46 |
| Ligand Information | | Ligands | ACT (ACETATE) x 1;ETX (2-ETHOXYETHANOL) x 2 | | Metals | CA (CALCIUM) x 2 | | |
Protein Summary
The yfcF from
Escherichia coli k12encodes glutathione S-transferase (subfamily 4).
This structure is structural and sequentially homologous to Glutathione S-transferase (GST, eg 6gss)
The A71 (glu) is important by structural alignment, also A71 is a clearly defined Ramachandran outlier. It is interesting to note that 40-57 is disordered, this seems to correlate with empty active site, it is likely that this segment is important for substrate binding.
PFAM entry
http://pfam.sanger.ac.uk/family?acc=PF02798
Putative catalytic tyrosine is Tyr18. The additional analysis needs to be done to confirm Arg58 role in GSH binding.
Ligand Summary
References