| Title | Crystal structure of dimeric ferredoxin-like protein of unknown function (YP_511867.1) from Jannaschia sp. CCS1 at 2.30 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 378282 | | Molecular Characteristics | | Source | Jannaschia sp. ccs1 | | Alias Ids | TPS1719,YP_511867.1 | Molecular Weight | 11252.27 Da. | | Residues | 102 | Isoelectric Point | 4.75 | | Sequence | mlyhlvmlepegegamdrimeamaildglapelpgltefrhgpnrdfeqkserypygflctftdkaald ayavhpthqraggmlvascrngadgilvvdlev | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 6 | | Resolution (Å) | 2.30 | Rfree | 0.222 | | Matthews' coefficent | 3.24 | Rfactor | 0.179 | | Waters | 175 | Solvent Content | 62.00 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
Gene Jann_3925 from Jannaschia sp. ccs1 encodes the YP_511867 amino acid sequence, a putative stress response protein from the Dabb family (PF07876). Its genome neighbor, Jann_3927, is annotated as transcriptional regulator of the LacI family (score 0.79).
3bb5 structure belongs to the SCOP alpha+beta class, ferredoxin-like fold, dimeric alpha+beta barrel superfamily, plant stress induced protein family. DALI top hits are with the RV0793 protein 1y0h (Z=13), 2fb0 (Z=13), 1tr0 (Z=13), and the ferredoxin-like protein 2qyc (Z=13).
Ligand Summary
References