.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bb5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of dimeric ferredoxin-like protein of unknown function (YP_511867.1) from Jannaschia sp. CCS1 at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 3bb5 Target Id 378282
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS1719,YP_511867.1, 3.30.70.900, 103515 Molecular Weight 11252.27 Da.
    Residues 102 Isoelectric Point 4.75
    Sequence mlyhlvmlepegegamdrimeamaildglapelpgltefrhgpnrdfeqkserypygflctftdkaald ayavhpthqraggmlvascrngadgilvvdlev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.222
    Matthews' coefficent 3.24 Rfactor 0.179
    Waters 175 Solvent Content 62.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bb5
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    Gene Jann_3925 from Jannaschia sp. ccs1 encodes the YP_511867 amino acid sequence, a putative stress response protein from the Dabb family (PF07876). Its genome neighbor, Jann_3927, is annotated as transcriptional regulator of the LacI family (score 0.79).

    3bb5 structure belongs to the SCOP alpha+beta class, ferredoxin-like fold, dimeric alpha+beta barrel superfamily, plant stress induced protein family. DALI top hits are with the RV0793 protein 1y0h (Z=13), 2fb0 (Z=13), 1tr0 (Z=13), and the ferredoxin-like protein 2qyc (Z=13).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch