.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ba3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Pyridoxamine 5'-phosphate oxidase-like protein (NP_783940.1) from Lactobacillus plantarum at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3ba3 Target Id 378137
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS1709,NP_783940.1, 336089 Molecular Weight 16043.42 Da.
    Residues 144 Isoelectric Point 4.81
    Sequence mdisllkqvvqstnkialstavnneadvkivnfvwyeaqpdtlyfssvktspalkvydqnpdiafitip ndgtagnpylraqhvklqrstktmtdllpqyletvpnyqqvwdaigstlvvfelkltdlfvdagvggek qtltfn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.196
    Matthews' coefficent 3.33 Rfactor 0.170
    Waters 413 Solvent Content 63.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ba3
    1. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     

    Protein Summary

    This protein has a FMN-binding split barrel fold.  Structurally, it is to the PNP-oxidase like family from SCOP.  It is also structurally similar to CREG (PDB code: 1xhn), which Sacher et al. have shown does not bind FMN.  However, the residues which interfere with FMN binding in 1xhn do not superimpose to any residues in this structure.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch