.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b81

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of predicted DNA-binding transcriptional regulator of TetR/AcrR family (NP_350189.1) from Clostridium acetobutylicum at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 3b81 Target Id 379155
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS1733,NP_350189.1, _0073.003939_ Molecular Weight 23233.48 Da.
    Residues 202 Isoelectric Point 5.54
    Sequence msrtninfnnkrtelankiwdifiangyenttlafiinklgiskgalyhyfsskeecadaaienrvaff snevlkeseeglnsierlkkillagikitsvneqvkeinspsnkifhqklmvaiikyfapiyadiisqg neegvfkvkypletaeiiltlshfyldedlfkwkkedmslkltafketlikildadedtfdfik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.234
    Matthews' coefficent 3.03 Rfactor 0.203
    Waters 82 Solvent Content 59.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b81
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    Predicted DNA-binding transcriptional regulator of TetR/AcrR family encoded by NP_350189 has structural similarity to 2f07A, 2hytA, 1zk8A and other protein structures [FATCAT]. According to the string.de server, NP_350189 has functional associations with possible ketopantoate reductase PanE/ApbA (CAC3607), transcriptional regulators (CAC0821, CAC3345, and CAC0724), and siderophore/surfactin synthetase related protein (CAC3554).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch