.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b7f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Domain of Unknown Function with a 7-Bladed Beta-Propeller Fold (YP_299179.1) from Ralstonia eutropha JMP134 at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 3b7f Target Id 377390
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS1688,YP_299179.1, 335772 Molecular Weight 43215.17 Da.
    Residues 393 Isoelectric Point 6.04
    Sequence mtastapqtephktsapesgpvmllvatikgawflasdparrtwelrgpvflghtihhivqdpreperm lmaartghlgptvfrsddgggnwteatrppafnkapegetgrvvdhvfwltpghasepgtwyagtspqg lfrstdhgaswepvagfndhpmrrawtggeqdgtpdgpkmhsilvdprdpkhlyigmssggvfestdag tdwkplnrgcaanflpdpnvefghdphcvvqhpaapdilyqqnhcgiyrmdrregvwkrigdamprevg digfpivvhqrdprtvwvfpmdgsdvwprvspggkpavyvtrdageswqrqdrglptdqawltvkrqam tadahapvgvyfgttggeiwasadegehwqciashlphiyavqsarpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.216
    Matthews' coefficent 3.01 Rfactor 0.168
    Waters 266 Solvent Content 59.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b7f
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Modeling discrete heterogeneity in X-ray diffraction data by fitting multi-conformers
    H Van Den Bedem, A Dhanik, JC Latombe - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Sequence and structural analysis of the Asp-box motif and Asp-box beta-propellers; a widespread propeller-type characteristic of the Vps10 domain family
    E Quistgaard, S Thirup - BMC structural biology, 2009 - biomedcentral.com
     

    Protein Summary

    Gene Reut_B4987 from Ralstonia eutropha jmp134 codes for the YP_299179 protein showing 5 detectable copies of the BNR (bacterial neuraminidase repeat)/Asp-box repeat (PF02012) from Pfam: 83-94, 140-151, 201-212, 315-326, and 365-376.  Residues 81-374 hit with the COG4447: Uncharacterized protein related to plant photosystem II stability/assembly factor using CD-Search. BNR motifs are found in many glycosyl hydrolases.

    Pre-SCOP classifies 3b7f in the all beta class, 7-bladed beta-propeller fold, oligoxyloglucan reducing end-specific cellobiohydrolase (super)family. DALI top hits are with the xyloglucan hydrolase PDB:2cn3 (Z=29), the oligoxyloglucan PDB:2ebs (Z=28) and the xyloglucanase PDB:3a0f (Z=27). It is structurally similar to all of the chains of PDB:1jof (Z=26), PDB:1sqj (Z=28), and PDB:2ebs.  However, none of the active site residues from either 1sqj or 2ebs are conserved in 3b7f. His148 from 1jofA can be aligned to His169 from this structure using Dali or VAST.  However, this is not enough conservation to suggest that 1jof and 3b7f have the same function.
     

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch