.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b7c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of NTF-2 like protein of unknown function (NP_715767.1) from Shewanella oneidensis at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3b7c Target Id 378232
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS1717,NP_715767.1, 3.10.450.50, 92079 Molecular Weight 14122.40 Da.
    Residues 121 Isoelectric Point 5.02
    Sequence mptddivqllkgqeeawnrgdldaymqgywqneqlmlisngkfrngwdetlaaykknypdkeslgelkf tikeikmlsnyaamvvgrwdlkrlkdtptgvftllvekiddrwvitmdhssd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.214
    Matthews' coefficent 2.75 Rfactor 0.184
    Waters 162 Solvent Content 55.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b7c
    1. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary

    SO_0125 gene from Shewanella oneidensis encodes the NP_715767.1 protein. It shows insignificant sequence similarity to PF08332. The gene fusion of SO_0125 with the asparaginase family protein SO_2115 indicates the functional association with this medically important protein family. The function of SO_0125 genomic neighbor (SO_0124) is unknown.

    SCOP classifies 3b7c in the alpha+beta class, cystatin-like fold, NTF2-like superfamily. According to DALI, 3b7c has a structure similar to proteins with PDB codes 3hx8 (Z=17), 3cu3 (Z=16), 2r4i (Z=15), 1oun (Z=14), 1tp6 (Z=14), 1hkx (Z=14). It is likely that 3b7c forms a dimer in solution. More analysis is needed to see if the dimer could further multimerize into a tetradecameric assembly as does the association domain of Ca2+/calmodulin-dependent kinase II (CaMKII, PDB code 1hkx).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch