.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b5o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of CADD-like protein of unknown function (ZP_00108531.1) from Nostoc punctiforme PCC 73102 at 1.35 A resolution (hexagonal form). To be published
    Site JCSG
    PDB Id 3b5o Target Id 377778
    Related PDB Ids 3b5p 
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1691,NPUN_22DEC03_CONTIG1_REVISED_GENENPF6505 Molecular Weight 27098.38 Da.
    Residues 243 Isoelectric Point 4.63
    Sequence mefnhltkqlnqllaqdyvafsitenpvvqmlsqasfaqiayvmqqysifpkelvgftelarrkalgag wngvaqelqenideemgsttggishytlladgleeglgvavkntmpsvatskllrtvlslfdrqvdyvl gatyaieatsipeltlivklvewlhegaipkdlqyffskhldeweieheaglrtsvaayiqpeefgefa agframidamqvwwqelaqeaissevvlstaiaqhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.174
    Matthews' coefficent 2.93 Rfactor 0.155
    Waters 242 Solvent Content 57.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b5o
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The Npun_F6505 gene from Nostoc punctiforme pcc 73102 encodes the NP_001869710 protein of unknown function and adopts a heme oxygenase-like fold. HHPred strongly predicts homology with the TENA/THI-4/PQQC family (PF03070, P-value3.8E-21, residues 22-226), a prediction also supported by structural similarity (PDB id: 1RCW, FATCAT P-value 2.78e-12, DALI Z-score 18.0). The similarity with PDB id 1RCW suggests a role in host cell apoptosis modulation [Ref]

     

    To do: compare 1RCW di-iron center/coordinating residues/death domain interacting surface with Npun_F6505.

     

    Top FFAS hits include TENA family transcription activators:

    # Score Template Links and tools %id First MEFNHLTKQLNQLLAQDYVAFSITENPVVQMLSQASFAQIAYVMQQYSIFPKELVGFTELARRKALGAGWNGVAQELQENIDEEMGSTTGGISHYTLLADGLEEGLGVAVKNTMPSVATSKLLRTVLSLFDRQVDYVLGATYAIEATSIPELTLIVKLVEWLHEGAIPKDLQYFFSKHLDEWEIEHEAGLRTSVAAYIQPEEFGEFAAGFRAMIDAMQVWWQELAQEAISSEVVLSTAIAQHH Last
    1 -93.500 3b5o_A mol:protein length:244 CADD-like protein of unknown function  ali model follow..  100  2 MEFNHLTKQLNQLLAQDYVAFSITENPVVQMLSQASFAQIAYVMQQYSIFPKELVGFTELARRKALGAGWNGVAQELQENIDEEMGSTTGGISHYTLLADGLEEGLGVAVKNTMPSVATSKLLRTVLSLFDRQVDYVLGATYAIEATSIPELTLIVKLVEWLHEGAIPKDLQYFFSKHLDEWEIEHEAGLRTSVAAYIQPEEFGEFAAGFRAMIDAMQVWWQELAQEAISSEVVLSTAIAQHH 244
    2 -57.800 3bjd_A mol:protein length:332 Putative 3-oxoacyl-(acyl-carrier-protein) syn  ali model follow..  14  101 LSRALSEEDFQKRLEQEIAAQSRERHPMSQYVFSGSRAQLQVFLRHQWFRTFRLYRDAADLLVNLTDVD---EAAALARYLYGELGEEDEKGSHPRLLAKLLEAIGLEDFQAVSTMPEEIAYLNNRARAFRHEVGWGLAVFYITELVVPGNHEKLYRALLQA---GLSEDQAEYYKVHIS-LVPPRAKREWQLIARRIDVQFQNAFLTSLSQHFRVERAYYDAIWEEMQSVKGS......... 332
    3 -54.200 1rcw_A mol:protein length:231 CT610  ali model follow..  1 ..MMEVFMNFLDQLDLIIQNKHMLEHTFYVKWSKGTKEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLE---ARKLLLDNLMDEENG---YPNHIDLWKQFVFALGVEELEAHEPSEAAKAKVATFMRWCGDSLAAGVAALYSYESQIPRIAREKIRGLTEYFG--SNPEDYAYFTEHEE-ADVRHAREEKALIEMLL-KDDADKVLEASQEVTQSLYGFLDSFLDP------GTCCSCHQSY 231
    4 -51.300 3hlx_A mol:protein length:258 Pyrroloquinoline-quinone synthase  ali model follow..  3 ITDTLSPQAFEEALRAKGDFY-HIHHPYHIAMHNGTREQIQGWVANRFYYQTTIPLKDAAIMANCPDAQ---TRRKWVQRILDHDGSHG-EDGGIEAWLRLGEAVGLSRLSERHVLPGVRFAVDAYLNFARRACWQEAACSSLTELFAPQIHQSRLDSWPQHYP-WIKEEGYFFFRSRLS-QANRDVEHGLALAKAYCSAEKQNRMLEILQFKLDILWSMLDAMTMAYALQR........... 233
    5 -51.200 1otv_A mol:protein length:259 Coenzyme PQQ synthesis protein C  ali model follow..  1 MLITDTLQAFEEALRAKGDFY-HIHHPYHIAMHNGTRKQIQGWVANRFYYQTTIPLKDAAIMANCPD---AQTRRKWVQRILDHDGSHG-EDGGIEAWLRLGEAVGLSRLSERHVLPGVRFAVDAYLNFARRACWQEAACSSLTELFAPQIHQSRLDSWPQHYP-WIKEEGYFYFRSRLS-QANRDVEHGLALAKAYCSAEKQNRMLEILQFKLDILWSMLDAMTMAYALQR........... 233
    6 -46.900 3dde_A mol:protein length:239 TENA/THI-4 protein, Domain of Unknown Functio  ali model follow..  14  2 MSI-IDLTKLEQKVATMWDSI-LTNSPFIHEVLDGTKALYAIYMTETYHYTKHNAKNQALVGIMGKDLP-GKYLSFCFHHAHEEAG-------HELMALSDIASIGFEDVLSSKPLPATETLIAYLYWISATNPVQRLGYSYWAENVYGYIDPVLKAIQSTL---DLTPQSMKFFIAHSK-IDAKHAEEVNEMLHEVCTQEDVDSVVAVMENSLVLTARILDDVWKEYQLFQSGASDRYA... 233
    7 -40.900 3oql_A mol:protein length:262 TenA homolog  ali model follow..  10  19 .......PAWAQQLINDCSPARVVEHELYQQMRDAKLQIMRQYLIGGWPVVEQFAVYMAKNLTKTRFGREDMARRWLMRNIRVELN-------HADYWVNWCAAHDVEDLHDQRVAPELHALSHWCWQTSSSDSLAMAATNYAIEGATGEWSAVVCSTGVYAEAEETRKKSMKWLKMHAQY-DDAHPWEALEIICTLVSLQLQAELRQAVTKSYDYMYLFLERCIQLDKVKSPRGRVAALE.. 261
    8 -24.200 1udd_A mol:protein length:226 transcriptional regulator  ali model follow..  13  1 MRV-MITDKLRRDSEQIWKK--IFEHPFVVQLYSGTLEKFKFYVLQDFNYLVGLTRALAVISSKAEYPLMAELIELARDEVTVEV------ENYVKLLKEL--DLTLEDAIKTEPTLVNSAYMDFMLATAKGNIIEGLTALLPCFWS----YAEIAEYHKDKLRDNPIKIYREWGKVYLSNEYLNLVGRLRKIIDS-SGHSGYDRLRRIFITGSKFELAFWEMAWRG................ 214
    9 -24.200 2qzc_A mol:protein length:214 Transcriptional activator TenA-1  ali model follow..  2 MSIVGNVENLINGVGELWNK--YVKHEFILKMRDGSLDIFRYYLIQDGKYVEDMLRALLIASSKGPIDKVTKILNLVFSSRDKGL------ETHGKLYSKL--DISRDVIVKTGYNLINYAYTRHLYYYANLDWNKFLVAWTPCMFGYSIVGDYVIDS---------NEVYKTWASFYASTEYKKRIEAILYALDEV---SITEDLLNIFINSVRFEIGFWDASLRK................ 209
    10 -23.000 2f2g_A mol:protein length:221 SEED MATURATION PROTEIN PM36 HOMOLOG  ali model follow..  13  1 MEKRGVIDTWIDKHRSIYTA--ATRHAFVVSIRDGSVSSFRTWLGQDYLFVRRFVPFVASVLIRACKDSGESSDMEVVLGGIAS------LNDEIEWFKREG-SKWDVDFSTVVPQRANQEYGRFLEDLMSSKYPVIMTAFWAIEAVYQESFAHCLE-----DGNKTPVELTGACHRWGNDGFKQYCSSVKNIAERCLSGEVLGEAEDVLVRVLELEVAFWEMSRGG................ 220
    11 -22.500 1wwm_A mol:protein length:190 hypothetical protein TT2028  ali model follow..  11  1 ..MGMLGLDLLKEVPGLLEE--IKALPL-----RLDEERFRFWLQQDYPFVEALYRYQVGLLLEAPQAHRAPLVQALM-ATVEEL----------DWLLLQGASPS------APVHPVRAGYIALLEEMGRLPYAYRVVFFYFLNGLFLEAWAHHVPE---------EGPWAELSQHWFAPEFQAVLYDLEVLARGLWEDLDPEVVRTYLRRILEAEKATWS..................... 187
    12 -22.300 2rd3_A mol:protein length:223 Transcriptional regulator  ali model follow..  12  2 ..IDPFTMQVSQYLYQNAQSGDCISHPFVQGIGRGTLDKFRFYIIQDYLFLLEYAKVFALGVVKACDEAVMREFSNAIQDILNN-----EMSIHNHYIREL--QITQKELQNACPTLANKSYTSYMLAEFKGSIKEVAAAVLSCGWS----YLVIAQNLSQIPNALEHAFYGHWIKGYSSKEFQACVNWNINLLDSLSSKQEIEKLKEIFITTSEYEYLFWDMAYQS................ 223
    13 -22.100 2gm7_A mol:protein length:221 tenA homolog/Thi-4 Thiaminase  ali model follow..  13  1 MAL-GVTGELRRRADGIWQR--ILAHPFVAELYAGTLEKFKYYLLQDYNYLVNFAKALSLAASRAPSVDLMKTALELAYGTVTG-----EMANYEALLKEV--GLSLRDAAEAEPNRVNVSYMAYLKSTCLEGFYQCMAALLPCFWS----YAEIAERHGGKLRENPVHVYKKWASVYLSPEYRGLVERLRAVLDSS--GLSAEELWPYFKEASLYELEFWQAAYEG................ 214
    14 -22.000 2a6b_A mol:protein length:234 hypothetical protein spr0628  ali model follow..  1 MGSDKIMELTVGELLKSSQKQAAINHRFVKELFAGTIKVLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEAD---------EDGYFQKAFKELKVNDYLEVTLHPVTKAFQDLMYSAVSSDYAHLLVMLVIAEGL-------YLDWGSKDLALPEVYIHSEWINLHRGPFFAEWVQFLVDELNRVGNREDLTELQQRWNQAVALELAFFDIGYD................. 227
    15 -21.700 1z72_A mol:protein length:225 transcriptional regulator, putative  ali model follow..  11 FQPGLTVGELLKSSQKDWQA--AINHRFVKELFAGTIKVLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEAD---------EDGYFQKAFKELKVNDYLEVTLHPVTKAFQDLMYSAVSSDYAHLLVMLVIAEGL-------YLDWGSKDLALPEVYIHSEWINLHRGPFFAEWVQFLVDELNRVGNREDLTELQQRWNQAVALELAFFDIGYD................. 224
    16 -21.400 1rtw_A mol:protein length:220 transcriptional activator, putative  ali model follow..  11  1 ....MFSEELIKENENIWRR--FLPHKFLIEMAENTIENFEKWLVNDYYFVKNALRFMALLMAKAPD-DLLPFFAESIYYISKEL----------EMFEKKAQELGIS--LNGEIDWRAKSYVNYLLSVASLSFLEGFTALYCEEKAYYEAWKWVRENLKE------RSPYQEFINHWSSQEFGEYVKRIEKILNSLAGEFEKERAREVFKEVSKFELIFWDIAYG................. 207
    17 -20.900 1tyh_A mol:protein length:248 Transcriptional activator tenA  ali model follow..  10  1 MSL-KFSEECRSAAAEWWEG--SFVHPFVQGIGDGTLDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGRMASHAQGTYEA-----EMALHREFAELL--EISEEERKAFKPSPTAYSYTSHMYRSVSGNFAEILAALLPCYWLYYEVGEKLLHCDPG------HPIYQKWIGTYGGDWFRQQVEEQINRFDELSTEEVRAKMKENFVISSYYEYQFWGMAYRK................ 217
    18 -20.900 3mvu_A mol:protein length:226 TenA family transcriptional regulator  ali model follow..  11  2 ..MSEPYGKAFSLMRAEAEPRAYTHHAFVEGLKAGTLEAFLHYLQQDYVFLIHFSRAWALAVVKSETHSEMLAAVGTVNALVAE-----EMQLHIGICEAS--GISQEALFATRERAENLAYTRFVLEAGSGDLLDLLAALAPCVMG-------YGEIGKRLTAEATSTLYGDWIDTYGGDDYQAACKAVGTLLDDATSSPRWSRLCQTFHTATELEVGFWQMGLTP................ 226
    19 -20.600 1to9_A mol:protein length:260 THI-4 protein  ali model follow..  20 ........KFSEECRSAAAEEGSFVHPFVQGIGDGTLDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGRMASHAQGTYEA-----EMALHREFAELL--EISEEERKAFKPSPTAYSYTSHMYRSVSGNFAEILAALLPCYWLYYEVGEKLLHCDPG------HPIYQKWIGTYGGDWFRQQVEEQINRFDELSTEEVRAKMKENFVISSYYEYQFWGMAYRSDSAIKEVEECGASRHN 253
    20 -20.200 4fn6_A mol:protein length:229 thiaminase-2  ali model follow..  12  2 ........EFSQKLYQAAKPNDIYEDDFIQKMLLGNIDALRHYLQADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEG---------EVLAHDILAQIVGESYEETKVWPPSGDHYIKHMYFQARENAIYTIAAMAPCPYI----YAELAKRSQSDHKLNREKDTAKWFDFYSTEMDINVFESLMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTL................ 218

    Ligand Summary

     

    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch