.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b5e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of carboxylesterase (NP_108484.1) from Mesorhizobium loti at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 3b5e Target Id 377848
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS1694,NP_108484.1, 103552 Molecular Weight 23753.85 Da.
    Residues 222 Isoelectric Point 5.61
    Sequence migdgiensplltdlafpyrllgagkesreclfllhgsgvdettlvplarriaptatlvaargripqed gfrwferidptrfeqksilaetaafaaftneaakrhglnldhatflgysnganlvsslmllhpgivrla allrpmpvldhvpatdlagirtliiagaadetygpfvpalvtllsrhgaevdariipsghdigdpdaai vrqwlagpiaiaqad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.190
    Matthews' coefficent 3.19 Rfactor 0.163
    Waters 490 Solvent Content 61.45

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b5e
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Crystal structure of the predicted phospholipase LYPLAL1 reveals unexpected functional plasticity despite close relationship to acyl protein thioesterases
    M Brger, TJ Zimmermann, Y Kondoh, P Stege - Journal of Lipid , 2012 - ASBMB
     
    3. Insights into the fatty acid chain length specificity of the carboxylesterase PA3859 from Pseudomonas aeruginosa: A combined structural, biochemical and
    A Pesaresi, D Lamba - Biochimie, 2010 - Elsevier
     
    4. Crystal structure of the predicted phospholipase LYPLAL1 reveals unexpected functional plasticity in spite of close relationship to acyl protein thioesterases
    M Burger, TJ Zimmermann, Y Kondoh, P Stege - Journal of Lipid , 2011 - ASBMB
     

    Protein Summary

    Carboxylesterase (NP_108484; list of homologs) with structural similarity to carboxylesterases from Pseudomonas fluorescens (PDB code 1auo) and Bacillus cereus (PDB code 2h1i) and sequence similarity to predicted esterases (COG0400) and phospholipases/carboxylesterases (PF02230).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch